SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007558 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007558
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 1.44e-16
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 98-259,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000392
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007558   Gene: ENSCAFG00000005072   Transcript: ENSCAFT00000008160
Sequence length 428
Comment pep:known_by_projection chromosome:CanFam3.1:22:30581474:30594167:-1 gene:ENSCAFG00000005072 transcript:ENSCAFT00000008160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRGGRDSDHNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences E2RJX6 F7FSR9 M3XVV4
ENSCJAP00000039464 ENSMPUP00000003204 ENSCJAP00000039464 ENSCAFP00000007558 9615.ENSCAFP00000007558 XP_002742655.1.60252 XP_004754466.1.14098 XP_021553516.1.83697 XP_542618.2.84170 ENSCAFP00000007558 ENSMPUP00000003204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]