SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007836 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007836
Domain Number 1 Region: 102-313
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.59e-54
Family DBL homology domain (DH-domain) 0.0000768
Further Details:      
 
Domain Number 2 Region: 329-446
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007836   Gene: ENSCAFG00000005241   Transcript: ENSCAFT00000008454
Sequence length 542
Comment pep:known_by_projection chromosome:CanFam3.1:2:30450965:30463191:-1 gene:ENSCAFG00000005241 transcript:ENSCAFT00000008454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHDEVGGLLPIKRTIRVLDVSHPSFREQEEPSNKRVRPLARVTSLANLISPVRNGAVR
RFGQTIQSFTLRGDSRSPASAQKSSSRSTVPTPAKRRSSVLWSEMLDVSMKESLTTKEIK
RQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDAYIPLHEDLLA
RIGEATKPGGTVEQIGHILVNWLPGLNAYKGYCSNQLAAKALLDQKKQDPRVQDFLQRCL
ESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQPLEEAILIIQGVLSDIN
LKKGESECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKNGHKLYIFLFQDILVLTR
PVTRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDKAKNIFRVRFQDPS
PGQSHTLQANDVFHKQQWFNCIRSAIAPFQQAVGPADLQGLPELDEECGENDPSAGSIRA
RRRASTASSMTQVQVDGDTSECVSPVHTAEDVKSVKVHQTQSGFRKARDKAQFSGKRKET
LV
Download sequence
Identical sequences E2RHR9
ENSCAFP00000007836 XP_544275.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]