SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000007839 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000007839
Domain Number 1 Region: 115-326
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.98e-54
Family DBL homology domain (DH-domain) 0.0000768
Further Details:      
 
Domain Number 2 Region: 342-459
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-20
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000007839   Gene: ENSCAFG00000005241   Transcript: ENSCAFT00000008457
Sequence length 555
Comment pep:known_by_projection chromosome:CanFam3.1:2:30450968:30492080:-1 gene:ENSCAFG00000005241 transcript:ENSCAFT00000008457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NRYSLRRGSSFTFLTPGPHWDFTLKRKRRAKDDDVVSLNSLDLKEPSNKRVRPLARVTSL
ANLISPVRNGAVRRFGQTIQSFTLRGDSRSPASAQKSSSRSTVPTPAKRRSSVLWSEMLD
VSMKESLTTKEIKRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGD
LDAYIPLHEDLLARIGEATKPGGTVEQIGHILVNWLPGLNAYKGYCSNQLAAKALLDQKK
QDPRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILRHTPKDHPDVQPLEE
AILIIQGVLSDINLKKGESECQYYIDKLEYLDEKQKDPRIEASKVLLCHGELKNKNGHKL
YIFLFQDILVLTRPVTRNERHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSDK
AKNIFRVRFQDPSPGQSHTLQANDVFHKQQWFNCIRSAIAPFQQAVGPADLQGLPELDEE
CGENDPSAGSIRARRRASTASSMTQVQVDGDTSECVSPVHTAEDVKSVKVHQTQSGFRKA
RDKAQFSGKRKETLV
Download sequence
Identical sequences F1P7U3
ENSCAFP00000007839 ENSCAFP00000007839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]