SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008031 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008031
Domain Number 1 Region: 3-409
Classification Level Classification E-value
Superfamily Serpins 1.17e-100
Family Serpins 0.00000122
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008031   Gene: ENSCAFG00000005386   Transcript: ENSCAFT00000008665
Sequence length 418
Comment pep:known_by_projection chromosome:CanFam3.1:21:23033455:23042446:-1 gene:ENSCAFG00000005386 transcript:ENSCAFT00000008665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFLLLLNTCCLLAVVLAAEVKKPAAAAAPGSAEKLSPKAATLAERSAGLAFSLYQAMAK
DQAVENILLSPVVVASSLGLVSLGGKATTASQAKAVLSAEQLRDEEVHAGLGELLRSLSN
STARNVTWKLGSRLYGPSSVSFAEDFVRSSKQHYNCEHSKINFRDKRSALQSINEWAAQT
TDGKLPEVTKDVERTDGALLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRT
GLYNYYDDEKEKLQIVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKK
AVAISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWD
TEGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL
Download sequence
Identical sequences E2RHY7
ENSCAFP00000008031 9615.ENSCAFP00000008031 ENSCAFP00000008031 NP_001159360.1.84170 XP_005633353.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]