SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008147 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000008147
Domain Number - Region: 121-209
Classification Level Classification E-value
Superfamily Kelch motif 0.00863
Family Kelch motif 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008147   Gene: ENSCAFG00000005458   Transcript: ENSCAFT00000008784
Sequence length 233
Comment pep:known_by_projection chromosome:CanFam3.1:22:46198911:46225152:1 gene:ENSCAFG00000005458 transcript:ENSCAFT00000008784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGMASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKTCVTDST
GVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIAC
LAGIVFILSGLCSMTGCSLYANKITTEFFDPLYVEQKYELGAALFIGWAGASLCIIGGVI
FCFSISDNNKPPRMGYAYNGATSVLSSRTKYPGAEGDFKTTNPSKQFDKNAYV
Download sequence
Identical sequences E2RBC2
XP_534163.2.84170 ENSCAFP00000008147 ENSCAFP00000008147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]