SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008192 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008192
Domain Number 1 Region: 1369-1483
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-34
Family Pleckstrin-homology domain (PH domain) 0.00099
Further Details:      
 
Domain Number 2 Region: 1174-1351
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-16
Family DBL homology domain (DH-domain) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008192   Gene: ENSCAFG00000005483   Transcript: ENSCAFT00000008831
Sequence length 1624
Comment pep:known_by_projection chromosome:CanFam3.1:15:18160817:18178389:1 gene:ENSCAFG00000005483 transcript:ENSCAFT00000008831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPKPSTPQSSPSHHQISWWPRGLSPLRRNYAMVQLTVASTGPEIRDIRSKASLDLQGR
WPCWPPAATPGSSSGTSPGAPVSAHCVHHVPPGPCSLGICSWPSRPQEPEPVEDCVQSTL
AALYPPFEATAPTLLGQVFQVVERTYREDALRYTLDFLVPAKHLLAKVQQEACAQYSGFL
FFHEGWPLCLHEQVVVQLAALPWQLLRPGDFYLQVVPSAAQAPRLALKCLAPGGGRVQEL
PVPNEACAYLFTPEWLQGINKDRPTGRLSTCLLSAPSGIQRLPWAELICPRFVHKGGLMV
GHRPSTLPPKLPSGPPGLPSPPLPEEALGTRSPGDGHNAPAEGPEGEYVELLEVTLPVRG
SPTDAQGSEGLPRTRTVPTRKGAGGKGRHRRHRAWMHQKGLGPRDQDGVRPPGEGSSTGA
SPGSPPGAEALPEAAALEASESPAETLGEASESFPLRSGDLGGGAGQGAEGPPDTPRRTG
KGNRRKKRAAGRGALSRGGDSAPLSPGDKDEASHQEVPVSLHPPNEHELPGCSLLEEEHG
GSGKPEPELKEELKPADKKEPQPQEACGPLGEPATEKDPEGPSLASAAGPTGPEGLVSDP
PPPPLETAQEVGGASVPEEASPVSISDDPDVAWDLMASGFLVLTGGVDQSGRALLTITPP
GPPEEPPPSQHVLSTALRYLHSLLRPDLQILGLSVLLDLRKAPPLPPALIPVLSQLQDSG
DPPLIQRLLVLTHDDPLTEPCGLQGAELLSESDLKRVAKPEELPWDLGGHREPSPSYWVE
THQEVARLCRLCRGVLCSVRRAIEELEGAAEPAGEEAAGMLEPLQKVLADPRLTELQRDG
GAILMRLRSTHSSKLEGPGPAAVYQEVDEAIHQLVRLSNLHVQRREQRQRLQRLQQVLQW
LSGPGEEQLASFAVPGDSLSALQETELQFRAFSTEVQERLAQAREALALEEDAASQKVLD
VFEQRLEQAESGLHRALRLQRFFQQAHEWVNEGAARLAGAGPGREAALAALALRRAPEPS
AGSFQEMRALALDLGSPAALREWGRCRARCQELERRIQQQLGEEASPRGQRRRRADSASS
GGAPRGPHSPAPSLSSLLLPGSPGPRAAPSHGSLAPCGEDCADDGPDPAAEAEAGPARPV
LIRGLEVSSTEVVDRTCSPREHVLLGRAGGPEGPWGGGTPRMERKRSLSAQQRLVSELIA
CEQEYVAALSEPAPPPGPELTPDLRGTWAAALGARERLRSFHRTHFLRELQGCAAHPLRI
GACFLRHGDQFSLYAQYVKHRHKLENGLAALGPPTKGSVESGPHLPRALEQPLEQLAQYG
RLLEELLREAGPELSSERQALGAAVQLLREQETRGRDLLAVEAVRGCETDLKEQGQLLHR
DPFTVICGRKKCLRHVFLFEHLLLFSKLKGTEGGSETFVYKQAFKTADMGLTENIGDSGL
CFELWFRRRRAREAYTLQAASPEIKLKWTSSIAQLLWRQAAHNKELRVQQMVSMGIGNKP
FLDIKALGERTLSALLTGRAARTRASVAVSSFEHAGPSLPGLSPGACSLPARVEEEAWDL
DVKQISLAPETLDSSGDVSPGPRNSPSLQPPHPGSSTPTLASGGILGLSRQSHARALSDP
TTPL
Download sequence
Identical sequences F1PME6
ENSCAFP00000008192 ENSCAFP00000008192 XP_532621.4.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]