SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008251 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008251
Domain Number 1 Region: 61-254
Classification Level Classification E-value
Superfamily Sec7 domain 1.96e-81
Family Sec7 domain 0.00000000414
Further Details:      
 
Domain Number 2 Region: 262-383
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-34
Family Pleckstrin-homology domain (PH domain) 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008251   Gene: ENSCAFG00000005506   Transcript: ENSCAFT00000008895
Sequence length 400
Comment pep:known_by_projection chromosome:CanFam3.1:9:2636945:2677481:1 gene:ENSCAFG00000005506 transcript:ENSCAFT00000008895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLKTAEEPVPSDLTAEERQELENIRRRKQELLADIQRLKDEIAEVANEIENLGSTEERK
NMQRNKQVAMGRKKFNMDPKKGIQFLIENDLLKNTCEDIAQFLYKGEGLNKTAIGDYLGE
RDEFNIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNNG
VFQSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYES
IKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLVGGRVKTWKRRWFILTDNCLYYFEYTTD
KEPRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRIS
APTPEEKEEWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
Download sequence
Identical sequences F1PKP6
ENSCAFP00000008251 ENSCAFP00000008251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]