SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008359 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008359
Domain Number 1 Region: 23-132
Classification Level Classification E-value
Superfamily PH domain-like 3.29e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008359   Gene: ENSCAFG00000005594   Transcript: ENSCAFT00000009009
Sequence length 242
Comment pep:known_by_projection chromosome:CanFam3.1:21:24592028:24608029:-1 gene:ENSCAFG00000005594 transcript:ENSCAFT00000009009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAAPVPPDPILESPFEEMALVRGGWLWRQSSILRRWKRNWFALWLDGTLGYYHDETAQ
DEEDRVLIQFNVRDIKIGQECRDVQPPEGRSRDGLLTVNLREGSRLHLCAETKDDAIAWK
TALLEANSTPAPAGATVPPRSRRVCPKVRCVTRSWSPCKVERRIWVRVYSPYQDYYEVVP
PNAHEATYIRSYYGPYAGPGVTHVVVREDPCYSAGAPLAMGMLAGAATGAALGSLMWSPC
WF
Download sequence
Identical sequences E2REV8
ENSCAFP00000008359 9615.ENSCAFP00000008359 XP_013978288.1.84170 XP_850310.1.84170 ENSCAFP00000008359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]