SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008388 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008388
Domain Number 1 Region: 95-272
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.08e-63
Family F-box associated region, FBA 0.0000212
Further Details:      
 
Domain Number 2 Region: 8-48
Classification Level Classification E-value
Superfamily F-box domain 0.00000262
Family F-box domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008388   Gene: ENSCAFG00000005622   Transcript: ENSCAFT00000009044
Sequence length 276
Comment pep:known_by_projection chromosome:CanFam3.1:1:114182010:114187516:1 gene:ENSCAFG00000005622 transcript:ENSCAFT00000009044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGARPSRRQLPAEPPLALDALPPELLVQVLGHVPPRALVTRCAPVCRACADVDGPTVGLA
ELARDRSAEGRALYAVAQRCPPHGEDEEFPLCALARYCLRAPLGRNLIFNSCGEQGFRGW
EVEHGGNGWAVEKNLTLVPGAPSQTCFVTSFQWCFKRQLVDLVMEGVWQELLDSAQIEIC
VADWWGARENCGCIYRLRVRLLDTYENEVVKFSASPNPVLQWTERGCRQVSHVFTNFGKG
IRYVSFEQYGRDTRSWVGHYGALVTHSSVRVRIRLS
Download sequence
Identical sequences E2RE11
ENSCAFP00000008388 ENSCAFP00000037266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]