SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008390 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008390
Domain Number 1 Region: 1066-1277
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-53
Family DBL homology domain (DH-domain) 0.0002
Further Details:      
 
Domain Number 2 Region: 1742-1982
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000256
Family WD40-repeat 0.012
Further Details:      
 
Domain Number 3 Region: 1269-1366
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000652
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008390   Gene: ENSCAFG00000005619   Transcript: ENSCAFT00000009046
Sequence length 2067
Comment pep:known_by_projection chromosome:CanFam3.1:21:24862295:24919667:-1 gene:ENSCAFG00000005619 transcript:ENSCAFT00000009046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGAPRSPLHRSVSFKLLERWSGGPGPKEAASDTPGLRRRASCRPAASVPGQPSRRVSK
LASGPPAAPAQPRPLRSLSPSVRQLSRRFDAPRPDDDHAGARDGGVSPGAAEEAAEGAAR
GAWPSVTEMRKLFGGPGSRRPSADSEASGTPSPDGAGWEPPAREPRQPPTPPPRTCFPLA
GLRSARPLPGPGTEGRRRRQQQQQQQQQERAQRPADGLHSWHSFSQPQAGAGARASCSCS
SSIASSYPVSRGRAASSSEEEEEGPPPPPPGAQSPAYHGGHSSGSDEDRDGEGGHRWGRP
GPRPGSSLSDKNCRPDSYGLNLGSMDSAGGARSPEPPKSPSEEGPPEWGTGSPPGVPGPQ
EGLRPMSDSGGAAFRVAKVSFPAYLASPAGSRGSSRYSSTETLKDEDPWASRGSGGWGMY
RSPSFGAGEGLLLRPQPRLRTKGAVGTTRALRDGGLELDQSRQRKSLSNPDIASETLTLL
SFLRSDLSELRVRKPSGRPSDLGSSPLDGRDSPSAGGPGAQLGPVPAPAPASPGTRPTLK
DLTATLRRAKSFTCSEKPMARRLCRTSTLKPSSSELLLAGPSAEEDPLPLVVQDQYVQEA
RQVFEKIQRMGAQQDDGSDVPPGSPDWAGDVTQGQRSQEELSGPESSLTDEGIGADPEPL
VSAFCSLGTTGVWRPLSSSSAQTNHHGPGAEDSLGGWALVSPDTPPTPGALRRRRKVPPS
GPGGTELSNGEAGEAYRSLSDPIPQRHRAATSEEPSGFSVDSNLLGSLSPKAGLPVAPAV
DEGLTSGHSDWSVGSEESKGYQEVIQSIVQGPGALGRVVDDRVAGKAPKKKSLSDPSRRG
ELAGPGFEGPGGEPIREVEPMLPPSSSEPILAERRAEPEEPSAARGRAQSERALPKTRAA
SSTAHRDFHLDPKLADVLSPRLIRRGSKKRPARSSHQELQREEADEDQTSSLSRARPSSK
HVRHASVPATFTPIVVPEPPTSIGPPVAVPEPVGFPARAHSTLQAPSLEDVTKQYMLTLH
SGEVPAPVPVDMPCLTPVALPSAEAKPPETARAPDEPAQASKCCSKPQVDMRKHVTMTLL
DTEQSYVESLRTLMQGYMQPLKQPENSLLCDPSLVDEIFDQIPELLEHHEQFLEQVRHCV
QTWHAQQKVGDLLVQSFSKDVLVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRE
NKEKQALSDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPLLLDAQRNIKQVAERINKGV
RSAEEAERHARVLQEIEAHIEGMEDLQAPLRRFLRQEMVIEVKAVGGKKDRSLFLFTDLI
VCTTLKRKSGSLRRSSMSLYTAASVIDTASKYKLLWKLPLEDADIIKGASQATNRENIQK
AINRLDEDLTTLGQMSKLSESLGFPHQSLDEALRDLSAAMHRDLSEKQALCYALSFPPTK
LELCATRPEGTDSFIFEFPHPDARLGFEQAFDEAKRKLASSKSCLDPEFLKAIPIMKTRS
GMQFSCAAPTQSSCPEPMPEVWVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGA
VPGLQRRGHREQPASLRNPPETAMETPGPELDVEATDEEAATLAEPGPQPCLHISIAGSG
LEMAPGPAGGDPRPELVPFDSDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEAT
AETTSSEEEQEPGFLPLSGSFGPSGPCSTSPMDGRALRRSSHGSFTRGSLEDLLSVDPEA
YQSSVWLGTEDGCVHVYQSSDSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGELVVY
QREAGHFWDPQNFKSVTLGSQGSPITKMVSVGGRLWCGCQNRVLVLSPDTLQLEHTFYVG
QDSSRSVACMVDSSLGVWVTLKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQ
HKAACLRITALLVCEELLWVGTSAGVVLTMPTSPSTVSCPRAPLSPAGLGQGHTGHVRFL
AAVQLPDGFNLLCPTPPPPPDTGPEKLPSLEHRDSPRNRGPASARPKMLVISGGDGYEDF
RLSSGGGGSSETVGRDDSTNHLLLWRV
Download sequence
Identical sequences E2RE02
ENSCAFP00000008390 ENSCAFP00000008390 9615.ENSCAFP00000008390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]