SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008420 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008420
Domain Number 1 Region: 24-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.53e-57
Family FCH domain 0.0042
Further Details:      
 
Domain Number 2 Region: 568-653
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-21
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 3 Region: 471-538
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000114
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008420   Gene: ENSCAFG00000005633   Transcript: ENSCAFT00000009078
Sequence length 740
Comment pep:known_by_projection chromosome:CanFam3.1:21:25082580:25397717:1 gene:ENSCAFG00000005633 transcript:ENSCAFT00000009078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPPRKVKVTQELKNTQVEQMTKLQAKHQAECDLLEDMRTFSQKKAAIEREYAQGIQKL
ASQYLKRDWPGIKADDRIDYRSMYPVWKSFLEGTMQVAQSRINICENYKNFISEPARTVR
SIKEQQLKRCVDQLTKIQTELQETVKDLAKGKKKYFETEQMAHAVREKADIEAKSKLSLF
QSRISLQKASVKLKARRSECNSKATHARNDYLLTLAAANAHQDRYYQTDLVNIMKALDGN
VYDHLKDYLIAFSRTELETCQAVQNTFQFLLETSSKVVRDYNLQLFLQENAVFHKPQPFQ
FQPCDSDTSRQLESETGTTEEHSLNKEARKWATRVAREHKNIVHQQRVLDDLECHGVAVS
EQSRAELEQKIDEARENIRKAEIIKLKAEARLDLLKQIGVSVDTWLKSAMNQVMEELENE
RWARLPAVTNNDTLHSLNADPEREEGEEFEDNMDVFDDSSSSPSGTLRNYPLTCKVVYSY
KASQPDELTIEEHEVLEVIEDGDMEDWVKARNKVGQVGYVPEKYLQFPTSNSLLSMLQSL
AALDSRSHTSSNSTEAELVSGSLNGDASVCFVKALYDYEGQTDDELSFPEGAIIRILNKE
NQDDDGFWEGEFSGRIGVFPSVLVEELSASENGDTPWMREIQISPSSKPPGSLPPLPLYD
QPPSSPYPSPDKRSSQYFPRSPSANENSFLAESPGFSQAPRHTPETSYGKLRPVRAAPPP
PTQNHRRPAEKIEDVEITLV
Download sequence
Identical sequences F1PTW8
ENSCAFP00000008420 XP_542322.3.84170 ENSCAFP00000008420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]