SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008425 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008425
Domain Number 1 Region: 299-535
Classification Level Classification E-value
Superfamily VPS9 domain 1.7e-33
Family VPS9 domain 0.0037
Further Details:      
 
Domain Number 2 Region: 49-146
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000797
Family SH2 domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008425   Gene: ENSCAFG00000005642   Transcript: ENSCAFT00000009083
Sequence length 570
Comment pep:known_by_projection chromosome:CanFam3.1:1:114236414:114241360:1 gene:ENSCAFG00000005642 transcript:ENSCAFT00000009083 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQLEDKAPAGPINAERPILSQVNGAGETPVGVLGTPEPLLRLWRTSGVWQVPELDTQDA
EALLELWPPGSFLVTGYDPSQVLVLRTGASRGEVRTYQIQKLPGGVSLKYSNLCMPDLPH
LLAFLSASRDVLPRTLLLPPPTRRPGDQHAGPLQIGGVQLNMSERVLSVVNKLYVETHRG
WRTEQMPPETPPETAERHRSAPRNPAPHRVSWVEGPLSPEVHHAGPALASLVEETEKEDK
DENEDENEADFRDEENEPEDVLTHHIQALARARGSYVGRQFQGLRARLTSNTRGPHRPGD
AATELLQDVRHLLTDLQDHLSKDPDVRAVFGSLGPGTPQKDDGLGAAVEAALCRAVLAPL
KPALWTRLRTLRAGELRRLRQRQVALRAGAGPPGAQGAGLAGQGPAPALRSRIHARLAHL
HAACAPRRKVALLLAVCSDVYAGLARGENQEPLGADAFLPALTEELIWSPHIGETQLDVE
FLMELLDPDELRGEAGYYLTTWFGALHHIAHYQPDAGRAPQGLSSEARASLRQWHSRRTL
HRQDRQSHDGAQVSLSFEEPWVRDPVPRDQ
Download sequence
Identical sequences E2QUP8
ENSCAFP00000008425 ENSCAFP00000008425 XP_541634.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]