SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008494 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008494
Domain Number 1 Region: 952-1129
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.47e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00025
Further Details:      
 
Domain Number 2 Region: 196-223,288-426
Classification Level Classification E-value
Superfamily PH domain-like 1.49e-29
Family Pleckstrin-homology domain (PH domain) 0.00096
Further Details:      
 
Domain Number 3 Region: 664-835
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-27
Family Pleckstrin-homology domain (PH domain) 0.0041
Further Details:      
 
Domain Number 4 Region: 10-70
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000628
Family SAM (sterile alpha motif) domain 0.01
Further Details:      
 
Domain Number 5 Region: 561-638
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 0.00000000000207
Family Pyk2-associated protein beta ARF-GAP domain 0.0028
Further Details:      
 
Domain Number 6 Region: 1263-1418
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000012
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 
Domain Number 7 Region: 445-535
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000189
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Domain Number 8 Region: 872-978
Classification Level Classification E-value
Superfamily PH domain-like 0.000086
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000008494
Domain Number - Region: 1170-1246
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00139
Family Ras-binding domain, RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008494   Gene: ENSCAFG00000005677   Transcript: ENSCAFT00000009156
Sequence length 1436
Comment pep:known_by_projection chromosome:CanFam3.1:21:25492080:25531060:1 gene:ENSCAFG00000005677 transcript:ENSCAFT00000009156 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGDAALSVAEWLRALHLEQYTGLFEQHGLVWATECQGLSDARLVDMGMLLPGHRRRI
LAGLLRAHTPPTPAPRPTLRPVPMKRHVFRTPPVPATPPEPLPAAGEDEGLPAAPPIPPR
RSCLPPACFSAPSAAAPDPVLPPLPAKRHLAELSVPPVPPRTGTPRLLVSLPSKEEKLVS
PPLSSPPQPEPEEPPATFPRVPLQPLSPPPSPPEIPPKPLRLPPEFDDSDYDEAPEEGPG
APASLMTKKEELLVSQVPRAVRVASLLSEGEELSGEDDDQGDEDEDDHAYEGIPNGGWHT
SSLNSSLPSSLLIPELPPHPMDGLSGGSAPITSVIKAGWLDKNPPQGSYIYQKRWVRLDA
DHLRYFDSNKDAYSKRFISVACISRIAAIGDQKFEVITNNRTFAFRAESDVERKEWMQAL
QQAVARAQLSSTYPLGVRGSELPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGI
GITFIDMSVGNVKEADRRSFDLTTPYRIFSFSAESELEKEQWLEAMQGAIAEALSPCLPL
LGFPCGEGGKVSACVKVRALCGEHRGLGAGVSKVRSLKMDRKVWTETLIELFLQLGNGPG
NRFWAANVPPSEALQPNSGPGARRRHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTT
DLAETQALLGCGAGVNCFSGDPEAPTPLALAEQAGQTLQMEFLRNNRTTEVPRLDSMKPL
EKHYSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLSDGVLSYYENERAVTPN
GEIRASEIVCLAVPPPDTHGFEYTFEVYTEGERLYLFGLESAELAREWVKCIAKAFIPPL
AEDLLARDFERLGRLPYKAGLSLQRAQEGWSLTGSELRAVFPEGPCEEPLQLRKLQELSV
QGDSENQVLVLVERRRTLYIQGERRLDFTGWLGAIQKAAASSGDTLSEQQLGDSDIPVIV
YRCVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVRLKEGEQHVDDVSSALKRF
LRDLPDGLFTRAQRLAWLDASEIEDEEEKVSRYRELLARLPPVNRATVKALISHLYCVQC
FSDTNQMNTHNLAIVFGPTLFQTDGQDYKAGRVVEDLISHYVVVFSVDEEELRKQREEIT
AIVKMRVAGTASGTQQGGPLVWTLIWLVAEAGTARPLQIPASMTAEELTLEILDRRNVGI
RERDYWTCFEVNEREEAERPLHFSEKVLPILHGLGTDSYLVVKKQQSMDAMLLYLASHVG
DTKHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEIRSQRPWSGAPETSHRPE
KEWPVRSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCETQTELREWFATFLFV
QHDGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLSLLRNV
Download sequence
Identical sequences E2R818
ENSCAFP00000008494 ENSCAFP00000008494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]