SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008504 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008504
Domain Number 1 Region: 47-94,127-184
Classification Level Classification E-value
Superfamily PH domain-like 0.000000487
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008504   Gene: ENSCAFG00000005688   Transcript: ENSCAFT00000009168
Sequence length 270
Comment pep:known_by_projection chromosome:CanFam3.1:15:19128105:19128917:-1 gene:ENSCAFG00000005688 transcript:ENSCAFT00000009168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XALRPGGRGSRGSRWARTARGCCCCPGPGAGSGEADPGGGPAYAGRMLESSGCKALKEGV
LEKRSDGLLQLWKKKCCILTEEGLLLIPPKQLQQPPPPPPPQQPGPGPAEPSQPGAPAAA
SLEPPGKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCPQDQGWNAEITLQMV
QYKNRQAILAVKSTRQKQQHLVQQQPPPPQPPQPPQPPQPPQAQPKPPQPQQLHPHPHPH
PLPLPHPHPLAHPHPQPHGHRLLRSTSNSA
Download sequence
Identical sequences F1PRF0
ENSCAFP00000008504 ENSCAFP00000008504 9615.ENSCAFP00000008504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]