SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008542 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008542
Domain Number 1 Region: 412-802
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.31e-126
Family Oxysterol-binding protein 0.0000384
Further Details:      
 
Domain Number 2 Region: 40-127,158-278
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-24
Family Pleckstrin-homology domain (PH domain) 0.00000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008542   Gene: ENSCAFG00000005707   Transcript: ENSCAFT00000009206
Sequence length 902
Comment pep:known_by_projection chromosome:CanFam3.1:15:19339385:19441582:-1 gene:ENSCAFG00000005707 transcript:ENSCAFT00000009206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAGLADGEPDQTSILPYSEVAEVQETLLGDSKDVLGPSTVVANSDESQLLTPGKMSQRQ
GKEAYPTPTKDLYQPSFSPASPHSQGFERGKEDISQNKDESSLSMSKSKSESKLYNGSEK
DSSASSKLTKKESLKVQKKNYREEKKRATKELLSTITDPSVIVMADWLKIRGTLKSWTKL
WCVLKPGVLLIYKTQKNGQWVGTVLLNACEIIERPSKKDGFCFKLFHPLEQSIWAVKGPK
GEAVGSITQPLPSSYLIIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSISS
ESTHVTLYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESDNEVM
GKSEESDTDTSERQDDSYIEPEPIEPLKETTYTEQSHEELGEAGEASQTETVSEENKSLI
WTLLKQVRPGMDLSRVVLPTFILEPRSFLDKLSDYYYHADFLSEAALEENPYFRLRKVVK
WYLSGFYKKPKGLKKPYNPILGETFRCLWIHPRTNSKTFYIAEQVSHHPPISAFYVSNRK
DGFCLSGSILAKSKFYGNSLSAILEGEARLTFLNRGEDYVMTMPYAHCKGILYGTMTLEL
GGIVNITCQKTGYSAILEFKLKPFLGSSDCVNQISGKLKLGKEVLATLEGHWDSEVFIND
KKTDNSEVFWNPTPDIKQWRLIRHTVKFEEQGDFESEKLWQRVTRAINAKDQTEATQEKY
VLEEAQRQAARDRKTKSEEWTCKLFELDPLTGEWHYKFADTRPWDPLNDMIQFEKDGVIQ
TKVKHRTPMVSVPKMKHKPTRQQKKVAKGYSSPEPDIQDSSGSEAQSVKPNTRRKKGIEL
GDIQNSIESIKQTQEEIKRNIMALRNHLVSSAPATDYFLQQKDYFIIFLLILLQVIINFM
FK
Download sequence
Identical sequences F6Y5H1
ENSCAFP00000008542 XP_003639579.2.84170 ENSCAFP00000008542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]