SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008566 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008566
Domain Number 1 Region: 342-510
Classification Level Classification E-value
Superfamily Sec7 domain 7.98e-58
Family Sec7 domain 0.0000586
Further Details:      
 
Domain Number 2 Region: 553-686
Classification Level Classification E-value
Superfamily PH domain-like 1.66e-26
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008566   Gene: ENSCAFG00000005723   Transcript: ENSCAFT00000009231
Sequence length 811
Comment pep:known_by_projection chromosome:CanFam3.1:2:35027175:35084403:1 gene:ENSCAFG00000005723 transcript:ENSCAFT00000009231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACRDSLGQVEKILRLDQVVGSPRNIQHREEAVAAMEEDKLPSGEGGTAWDPSLEPEEEP
GVQNGMTHSQDLNSSYNSPGHEMRGTLVDTEESMQGPDMALRGLSLGLSFTNGPVLGPDS
NTLEDSAESRAWRVGGLAEGDNAPRNFCLDTEDPQLGLGGPGEPDVRDGFSATFEKIVES
ELLRGTQYSSLDSLDVLSLTDESDSCVSFEAPLTPLIQQRARDSPEPGAGLETGEMGPEG
DMGAAGGDGELGSPLRRSISSSRSENVLSRLSLTAVPNGFHEDGPQGPGGDEEEEVVEEE
EEDTDKLLNSASDPSLKDGFSDSDSELSSSEGLEPGSTDPLANGCQGVSEAARRLARRLY
HLEGFQRCDVARQLGKNNEFSRLVAGEYLSFFDFSGLTLDRALRTFLKAFPLMGETQERE
RVLTHFSRRYCQCNPEDSTSEDGIHTLTCALMLLNTDLHGHNIGKKMSCQQFIANLDQLN
DGQDFAKDLLKTLYNSIKNEKLEWAIDEDELRKSLSELVDDKFGTGTKKVTRILDGGNPF
LDVPQALSATTYKHGVLTRKTHADMDGKRTPRGRRGWKKFYAVLKGTILYLQKDEYRPDK
ALSEGDLKNAIRVHHALATRASDYSKKSNVLKLKTADWRVFLFQAPSKEEMLSWILRINL
VAAIFSAPSFPAAVSSMKKFCRPLLPSCTTRLCQEEQLRSHENKLRQVTSELAEHKCHPI
ERGVKSKEAEENRLKEHYLTFEKSRYETYIHLLAVKIKVGSDDLERIEARLATLEGDDPS
LRKTHSSPALSQGHGTVTGSKTTKDTTGPDT
Download sequence
Identical sequences F6X4N8
ENSCAFP00000008566 ENSCAFP00000008566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]