SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008727 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008727
Domain Number 1 Region: 313-485,525-694
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.09e-135
Family Mammalian PLC 0.0000000341
Further Details:      
 
Domain Number 2 Region: 926-980,1020-1170
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 1.57e-59
Family C-terminal domain of PLC-beta 0.0012
Further Details:      
 
Domain Number 3 Region: 141-312
Classification Level Classification E-value
Superfamily EF-hand 5.91e-55
Family EF-hand modules in multidomain proteins 0.00043
Further Details:      
 
Domain Number 4 Region: 12-140
Classification Level Classification E-value
Superfamily PH domain-like 1.91e-40
Family Pleckstrin-homology domain (PH domain) 0.00081
Further Details:      
 
Domain Number 5 Region: 716-831
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-27
Family PLC-like (P variant) 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008727   Gene: ENSCAFG00000005760   Transcript: ENSCAFT00000009402
Sequence length 1206
Comment pep:known_by_projection chromosome:CanFam3.1:24:12750503:13008097:-1 gene:ENSCAFG00000005760 transcript:ENSCAFT00000009402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKPYEFNWQKEVPSFLQEGAIFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRLGATPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPAAFTYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALKSM
MEAGESAAPVSILEDDNEEEIESADQEEEAHPEYKFGNELSADDLGHKEAVANSVKKASD
DLEHEINKKGLVTVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNI
HYNMSSFNESVGLGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVS
LNYQTPDLAMQLNQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVI
SGQFLSDKKIGTYVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLA
VLRIAVYDDNNRLIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGF
GDIVDALSDPKKFLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQ
SSSELRPTTTAAMGSGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAK
EHSTMQKLHCTQVDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSD
HKSKVKEIVAQHTKEWSEMINTHSAEEQEIRDLHLSQQCELLRKLLISAHEQQTQQLKLS
HDRESKEMRAHQAKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMK
QSKEMDQLKKVQLEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSV
KLQNAN
Download sequence
Identical sequences F1PLB3
ENSCAFP00000008727 ENSCAFP00000008698 XP_013962517.1.84170 XP_013962518.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]