SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008792 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008792
Domain Number 1 Region: 234-575
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.62e-131
Family Mammalian PLC 0.00000000116
Further Details:      
 
Domain Number 2 Region: 814-877,918-1089
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 5.1e-70
Family C-terminal domain of PLC-beta 0.0000281
Further Details:      
 
Domain Number 3 Region: 65-232
Classification Level Classification E-value
Superfamily EF-hand 1.71e-53
Family EF-hand modules in multidomain proteins 0.00000646
Further Details:      
 
Domain Number 4 Region: 595-713
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.13e-25
Family PLC-like (P variant) 0.0000707
Further Details:      
 
Domain Number 5 Region: 2-63
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000578
Family Pleckstrin-homology domain (PH domain) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008792   Gene: ENSCAFG00000005856   Transcript: ENSCAFT00000009472
Sequence length 1134
Comment pep:known_by_projection chromosome:CanFam3.1:24:13340367:13587106:-1 gene:ENSCAFG00000005856 transcript:ENSCAFT00000009472 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPKLRELLDVGNIGRLEHRMITVVYGPDLVNISHLNLVAFQEEVAKEWTNEVFSLATNLL
AQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSADRKRVETALEACSLPSSRNDSI
PQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYLTVDQMMDFINLKQRDPRLNEIL
YPPLKQEQVQVLIEKYEPNNSLAKKGQISVDGFMRYLSGEENGVVSPEKLDLNEDMSQPL
SHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCVELDCWKGRTAEEEPVITHGFTM
TTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQQAKMAEYCRLIFGDALLMEPLE
KYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKKKLSEQVSNTYSDSSSMFEPSSP
GAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEMSNLVNYIQPVKFESFEISKKRN
RSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPKGTRVDSSNYMPQLFWNAGCQMV
ALNFQTVDLAMQINMGMYEYNGKSGYRLKPEFMRRPDKHFDPFTEGIVDGIVANTLSVKI
ISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQGNAVNPVWEEEPIVFKKVVLPSL
ACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNERNQPLMLPAVFVYIEVKDYVPDT
YADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKKEADPGETPSEAPSEAGTNPAEN
GVNHTTSLAPKPPSQALHSQPAPGSVKAPAKTEDLIQSVLTEVEAQTIEELKQQKSFVKL
QKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYLRRRAALEKTAKKDSKKKSDPSS
PDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLRQEQYYSEKYQKREHIKLLIQKL
TDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKITEAKSKDKSQMEEEKTEMIRSY
IQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKPKLQMDLEQEYQDKFKRLPLEIL
EFVQEAMKGKISEESNHSSAPPSLASDPGKLNHKPPSSEELEGDNPGKEFDTPL
Download sequence
Identical sequences F1PL90
ENSCAFP00000008792 ENSCAFP00000039250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]