SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008814 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008814
Domain Number 1 Region: 24-153
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.16e-30
Family Cytidylyltransferase 0.0032
Further Details:      
 
Domain Number 2 Region: 214-349
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.7e-20
Family Cytidylyltransferase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008814   Gene: ENSCAFG00000005882   Transcript: ENSCAFT00000009494
Sequence length 385
Comment pep:known_by_projection chromosome:CanFam3.1:9:383744:389608:1 gene:ENSCAFG00000005882 transcript:ENSCAFT00000009494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRNGHGAAGGAEPPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDE
EISKHKGPPVFTQEERYKMVRAIKWVDEVVPAAPYVTTLETLDKYSCDFCVHGNDITLTV
DGRDTYEEVKAAGRYRECRRTQGVSTTDLVGRMLLVTKAHHSGQEISSEYREYADSFGKC
PGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHGLA
ERPYVIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLDHF
KVDLVCHGKTEIVPDKDGSDPYQEPKRRGIFCQIDSGSDLTTDLIVQRIIKNRLEYEARN
QKKEAKELAFLESRRRQEAQPETER
Download sequence
Identical sequences F1PIT0
ENSCAFP00000008814 ENSCAFP00000008814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]