SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000008867 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000008867
Domain Number 1 Region: 69-125
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-17
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000008867   Gene: ENSCAFG00000005920   Transcript: ENSCAFT00000009549
Sequence length 421
Comment pep:known_by_projection chromosome:CanFam3.1:1:114607058:114614163:-1 gene:ENSCAFG00000005920 transcript:ENSCAFT00000009549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KYARLALTPPPSRPLPLTHLPGSPSLPRRPGSRCPSLAPPEPAREPERTGGGGGGGGQVA
AARSPAGASQTTLECTLRPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAA
LAALGRGSLTPSSSSSSSSPSQDTAETPCPLTSHVDSESSSSHSRQETPPTTAAATIITV
ESASGFGPATSPQRRRSSAQSYPPLLPFTGIPEPSEPLAGAGGPGWGGRGYEDYRRAGPP
APLALSTCVVRFAKTGALRGAALGPPAALPAPLAEAAPPAPPARPPPGPGPAPAPAKASP
EAEEAARCVHCRALFRRRADGRGGRCAEAPDPGRLLVRRLSCLWCAESLLYHCLSDAEGD
FSDPCACEPGHPRPAARWAALAALSLAVPCLCCYAPLRACHWVAARCGCAGCGGRHEEAA
R
Download sequence
Identical sequences E2QY96
ENSCAFP00000008867 ENSCAFP00000008867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]