SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009039 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009039
Domain Number 1 Region: 2-355,385-404
Classification Level Classification E-value
Superfamily Thiolase-like 3.9e-74
Family Thiolase-related 0.0025
Further Details:      
 
Domain Number 2 Region: 2231-2508
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.12e-65
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.000000000461
Further Details:      
 
Domain Number 3 Region: 1645-1807
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.1e-41
Family Alcohol dehydrogenase-like, C-terminal domain 0.0001
Further Details:      
 
Domain Number 4 Region: 495-620,683-779
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 8.37e-40
Family FabD-like 0.0046
Further Details:      
 
Domain Number 5 Region: 1888-2077
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.62e-33
Family Tyrosine-dependent oxidoreductases 0.00022
Further Details:      
 
Domain Number 6 Region: 1563-1679
Classification Level Classification E-value
Superfamily GroES-like 0.00000000000000141
Family Alcohol dehydrogenase-like, N-terminal domain 0.0055
Further Details:      
 
Domain Number 7 Region: 1251-1423
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000639
Family Plant O-methyltransferase, C-terminal domain 0.051
Further Details:      
 
Domain Number 8 Region: 2130-2195
Classification Level Classification E-value
Superfamily ACP-like 0.000000000012
Family Acyl-carrier protein (ACP) 0.00012
Further Details:      
 
Domain Number 9 Region: 620-676
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000000759
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009039   Gene: ENSCAFG00000006006   Transcript: ENSCAFT00000009737
Sequence length 2518
Comment pep:known_by_projection chromosome:CanFam3.1:9:233692:249092:1 gene:ENSCAFG00000006006 transcript:ENSCAFT00000009737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVVIAGMSGKLPESDNMEEFWANLIGSVDMVTDDDRRWKAGLYGLPRRSGKLKDLSRF
DASFFGVHPKQAHTMDPQLRLLLEVAYEAILDGGINPASLRGTRTGVWVGVSGSEASEAL
SRDPETLLGYSMVGCQRAMMANRLSFFFDFKGPSVALDTACSSSLMALHSAYQAIRSGEC
PCAIVGGINILLKPNTSVQFMKLGMLSPEGICKSFDEAGAGYCRAEAVVAMLLTKKSLAR
RVYATILNAGTNTDGFKEQGVTFPSGEVQEQLIRSLYEPAGLAPESLEYIEAHGTGTKVG
DPQELNSIDRALCSTRREPLLIGSTKSNMGHPEPASGLAALAKVLLSLEHGLWAPNLHFH
SPNPEILALQDGRLQVVDRPRPVRGGNVGINSFGFGGSNVHVVLQPNTRPPRPTTPHITL
PRLLRASGRTPEAVRCLLEKGQQHSRDVAFVTMLNDIAASSPSAMPFRGYTVLGSEDGSH
EVQEVQQLPAGRRPLWFICSGMGAQWRCMGSSLLRLSSFHNSILRSSEALKPLGLQLPEL
LLSTDETTFDDIVHAFVSLTAIQIALIDLLTSMGLRPDGIIGHSLGEVACGYADGCLSQE
EAVLTAYWRGQCIKEASIPPGAMAAVGLTWEECKRRCPPGVVPACHNSEDTVTISGPQAE
VAAFLEELRQEGVFAKEVRTGGMAFHSYFMESIAPTLLKALKKVIREPKPRSARWLSTSI
PEAQWQGSLARMCSAEYSVNNLVSPVLFQEALCHVPEHAVVVEIAPHALLQAVLKRGLKP
SCAIIPLMKKEQKDNLEFFLRNTGKLHLLGMDANPNGLFPPMDFPVPRGTPLISPHIKWD
HSQIWDVPAAEDFPNGSTGSSAATICKIDTSPESPDHYLVDHCIDGRVLFPATGYLCLAW
KMLARALNQNMEEMPVVFEDVTLHQATILPKTGTMALEVRLLEASQSFEVSENGNLIVSG
KVYQWEDPDPKLFDLHGGADPVDPTDPTDPMAAFRLTQGDVYKELRLRGYDYGPHFQGIL
ETNLEGKAGQLLWKDNWVVFLDAMLQTSILGNPQRTLCLPTRITSIHIDPALHQQKVYSL
KGDARVVDVKVSSCLNSTVAGGALILGLHASVAPRRQQEQHAPILEKFSFTPYMEGGVLA
GNAALQEELQLCRGLAQALQTKVAQQGLKMVVPGLDGAQVPREFPQGGLPQLLAAACQLQ
LNGNLQLELAQLLAQQRSLLHDDPLLCGLLDSSALKACTDTALENMTSLRMHIVEVLAGD
GRLYTRIPTLLSTQPLLQLDYTATDRHPQALEAAQTKLQELGMAQGQWDPTQPAPSNLGT
ADLLVCNCAVATLPDPASALSHMVAAVREGGFLLLHALLRGHPLGETVAFLTGPEQQQQQ
QQLGGSQSLLSQDEWERVFAGASLHLVALKRSFYGSALFLCRRPGPQDSPVFLPVEDTSF
RWVDSLKNVLADSSSRPVWLTATNCITSGVVGMVNCLRKEPSGHRVRCLLPYLALSPSPL
PSLSSPLSPPLSSLPSLSSPLSAPPLPLHEEQTEHAFVNVLTRGDLSSIRWVCSPLRHAQ
LTEPGVQLCTVYYASLNFRDIMLATGKLSPDAIPGKWAARDCMLGMEFSGRDASGKRVMG
LVPAEGLATSVLLSPDFLWDVPSSWTLEEAATVPVVYTTAYYSLVVRGRVQRGETVLIHS
GSGGVGQAAIAIALSLGCRVFTTVGSAEKKAYLQARFPQLSDTSFANSRDTSFEQHVLRH
TAGKGVDLVLNSLAEEKLQASVRCLAQHGRFLEIGKFDLSNNHLLGMAVFLKNVTFHGIL
LDALFDEAGHGWREVAALLQAGIRDGVVRPLKRTVFPKNQVEDAFRFMAQGKHIGKVVVQ
VLEEEQEAALQVTRPTMMTAVSKTFCPAHKSYVITGGLGGFGLQLAQWLVLRGAQKLVLT
SRSGIRTGYQAKLIREWRRQGVQVLVSTSNIGSLDGAQSLIAEAAQLGPVGGVFNLAVVL
RDAMLENQTPEFFQDVNKPKYSGTVNLDRVTRAACPELDYFVAFSSVSCGRGNAGQTNYG
FANSTMERVCEKRRHDGLPGLAVQWGAIGDVGIILEMMGSNDTIVGGTLPQRMTSCLEVL
DLFLNQPHPVLSSFVLAEKKAAAQGDGSTQHDLMKAVAHILGIRDLATVNLDSTLADLGL
DSLMGVEVRQMLEREHDLVLSMRDIRQLTLRKLQELSSKAGMADERGVPTPKQDSPTYQQ
AQLNLSTLLVNPEGPTLTRLNSVQSSERPLFLVHPIEGSITVFHSLAAKLSIPTYGLQCT
RAAPLDSIQSLAAYYIECIRQVQPEGPYRIAGYSYGACVAFEMCSQLQAAQQSPAPTHNS
LFLFDGSHSYVLAYTQSYRAKMTPGCEAEAEAEAMCFFVQQFTDMEHDKVLEALLPLGSL
EERVVASVDLIQHSHAGLDPRELSFAARSFYHKLRAAEQYTPQATYHGNVTLLRAKTGSM
YGEGLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESILSIIHSSLAEPRVSVREG
Download sequence
Identical sequences F1Q2F6
ENSCAFP00000009039 ENSCAFP00000009039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]