SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009276 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009276
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 6.46e-27
Family SH2 domain 0.00000204
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000235
Family SOCS box-like 0.0000707
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009276   Gene: ENSCAFG00000006180   Transcript: ENSCAFT00000009997
Sequence length 199
Comment pep:known_by_projection chromosome:CanFam3.1:15:33785545:33826156:1 gene:ENSCAFG00000006180 transcript:ENSCAFT00000009997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGAEGTPSQWGPAGPAEEPTPEAARLAKALRELSHTGWYWGNMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQRH
Download sequence
Identical sequences F6XNR1
ENSCAFP00000009276 ENSCAFP00000009276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]