SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009291 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009291
Domain Number 1 Region: 160-295
Classification Level Classification E-value
Superfamily Cyclin-like 7.26e-51
Family Cyclin 0.00000217
Further Details:      
 
Domain Number 2 Region: 297-417
Classification Level Classification E-value
Superfamily Cyclin-like 1.79e-39
Family Cyclin 0.0000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009291   Gene: ENSCAFG00000006189   Transcript: ENSCAFT00000010017
Sequence length 421
Comment pep:known_by_projection chromosome:CanFam3.1:25:4189671:4198365:-1 gene:ENSCAFG00000006189 transcript:ENSCAFT00000010017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSSSKSGVALAPVSRGPDACQMITRAQLGQDPPQRTVLGVLTENGQYGRTCGQGITTI
RCFSGSENVVPPAGKKVFSDCRVQVPAKQGFHIYMDEAEQGDRDSCTGREGMAFEDVCGV
DTSTLKSDLHFLLDFNTVSPMLVDSSLHSQSEDASDFGTDVINVTEYAEEIHQYLREAEI
RHRPKAHYMRKQPDITESMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRG
KLQLVGTAAILLASKYEEIYPPEVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTT
NQFLLQYLRRQGVCIRTENLAKYVAELSLLEADPFLKYLPSLRAAAAYCLANYTVNRHFW
PETLAAFTGYSLNEIVPCLSELHKACLDIPHRPQQAIREKYKASKYMHVSLMEPPAVLPL
Q
Download sequence
Identical sequences F1PYU7
XP_005635513.1.84170 XP_005635514.1.84170 XP_013962913.1.84170 ENSCAFP00000009291 ENSCAFP00000009291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]