SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009304 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009304
Domain Number 1 Region: 50-465
Classification Level Classification E-value
Superfamily Sema domain 1.7e-48
Family Sema domain 0.01
Further Details:      
 
Domain Number 2 Region: 1068-1197,1371-1520
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 467-516
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000628
Family Plexin repeat 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009304
Domain Number - Region: 683-769
Classification Level Classification E-value
Superfamily E set domains 0.000638
Family E-set domains of sugar-utilizing enzymes 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009304   Gene: ENSCAFG00000006200   Transcript: ENSCAFT00000010032
Sequence length 1587
Comment pep:known_by_projection chromosome:CanFam3.1:15:34279503:34414767:1 gene:ENSCAFG00000006200 transcript:ENSCAFT00000010032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVSGRKAPPRPPRPPRAPRAPRPPRPAAPLPLLAYLLALAAPSRGADEPVWRSEQAIGA
IAASLADGVFVASGSCLDQLDYSLEHRLSRLYRDQAGNCTEPVSLAPPARPRPGSSFSKL
LLPYSEGAADPQRLLLTGWTFDRGACEVRLLGNLSHGSLRNGTEVVSCHPQGSTAGVVYR
AGERNRWYLAVAATYVLPEPETASRCNPAASDRDTAIALKDTEGRSLATEELGRLKLRGG
AGSLHFVDAFLWNGSVYFPYYPYNYTSGAATGWPSMVRIAQSAKVLQFQGQAALDCGHGH
PDGRRLLLSSSLVEALGVWAGVFSAATGEGQERRSPATTALCLFRMSEIQERAKSCPWDF
QMAEHNCKDGEQPERVPPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGEN
LTSNCPEVIYEIKEETPIFYKLVPHPKKNIYIYLTAGKEVRRIRVANCSKHQSCMECLKV
ADPHCGWCHSLQRCTFKEDCVNPEYENWLDISSGAKKCPQINLFRSSKDKTTVTVVGSFP
PRRSDWECVVKNPDTGRQLCKGRSPPDKICTCSIPTRATYKDVLVVNVTFSVDSWHLSKR
FNFTNCSSLRECPVCIGTGCAWCKSERKCIHPFTACDPSDYKRNQEHCQVAVEKWVPSKT
AGEGRFPESKSNRTTQGLQVFYIKSIEPRKISTLGKSNVIVTGANFTRASNITMILKGTS
TCDKDVIQVSHVLNDTHMKFSLPSSRKEMKDVCIQFDGGDCTSVGPLSYIALPRCSLIYP
ATTWISGGQNITIIGRNFDVIDNLIISHELKGNINVSEYCMATSCRFLAPSLKSLKARTN
VTVKLRVQETYLECGSLQYLEDPRFTGCRVEPEGDTELEVKIQKENDEFNISKTDIEITL
FHGENEQLNCSFENITRNQDLTIILCKIKGITNANSIDTSSKKVRVKLGNLELYVEQETV
PTTWYFLIVLPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQM
DKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDATDKNESLTALDALIC
NKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNMQ
PKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKAL
YTLNEDWLLWQVPEFNTVALNVVFERIPENESADVCRNISVNVLDCDTIGQAKEKIFQAF
LSKNGSPYGLQLNEIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIK
GFKKIANFTSDVEYSEDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAI
HSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVN
ILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEE
VKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLER
ERGLEEAQKQLLHVKVLFDEKKKCKWM
Download sequence
Identical sequences E2QY27
ENSCAFP00000009304 ENSCAFP00000009304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]