SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009347 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009347
Domain Number 1 Region: 596-783
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-53
Family DBL homology domain (DH-domain) 0.00000000812
Further Details:      
 
Domain Number 2 Region: 788-927
Classification Level Classification E-value
Superfamily PH domain-like 1.8e-38
Family Pleckstrin-homology domain (PH domain) 0.00000017
Further Details:      
 
Domain Number 3 Region: 274-424
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-17
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 1027-1083
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000489
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 41-193
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000916
Family CRAL/TRIO domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009347
Domain Number - Region: 435-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00226
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009347   Gene: ENSCAFG00000006240   Transcript: ENSCAFT00000010077
Sequence length 1125
Comment pep:known_by_projection chromosome:CanFam3.1:22:60474400:60569174:1 gene:ENSCAFG00000006240 transcript:ENSCAFT00000010077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFWLRNEEMALEAMVQRLTAVCKRTDEIMHQDITPLCAADIQDQLKKRFAYLSGGRGQD
GSPVITFPDYPAFSDVPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASIL
RIAASFPANLQLVLVLRPTGFFQRALSDLAFKFNRDDLKMKVPVIMLSSVPELHGYIDKS
QLTEDLGGTLDYCHTRWLCHRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSV
LCAHTEKKDKAKEDMRLALDEGKSILENIREPLAKSGEQSLNQDELDNQTTVQRLLAQLN
ETEAAFDEFWAKHQQKLQQCLQLRHFEQDFREVKSSLDALAQKIATFTDVGNSLAHAEHL
LKDLASFEEKSSASVKRAHTLSLEGEKLIDTKHYAVDSIRPKCHELQYLCDQFAAEVERR
RGLLSKSLELHGLLEASMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENK
IQELNKIYQDYESILTKDLMEHVQKVFQKQEGMEEMFHRRQASLKKLAAKQMRPVQPVAP
RPEALTKSPCPSPGSRRGSENSSEGSTLRRGPYRRAKSEASEGRQGRSSSTGHEEESLAV
LRRHVMNELLDTERVYVEELLCVLEGYAAELDNPLMAHLMSPGLQNKKDILFGNMEEIYH
FHNRIFLRELEEYTDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQEC
QRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKSCEGAEDLQEALSSILGILKAVND
SMHLIAITGYDGNLSDLGKLLMQGSFSVWTDHKKGHSKVKDLARFKPMQRHLFLHEKAVL
FCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDVRKFEIWYNAREEVYIVQAPTP
EVKAAWVSEIRKVLTSQLQACREASQHRTLEQSQSLPLPTPPSTSPSKGTTRNIKKLEER
KTDPLSLEGYMSPSSLPKPPEKGRGWSKTSHPLEAPEDNDGWSSAEELMNSSDAEEEGRV
GPRKLVPGKYTVVVDDEKGSPEALAVRNGDMVEVVQEGDEGLWYVRNLTSSKESWVPASS
LSALLGVSGSAQCLSSSESSAGSTLLSASSSCSESCGVPLSDLQG
Download sequence
Identical sequences F1PWY8
XP_013961940.1.84170 ENSCAFP00000009347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]