SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009352 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009352
Domain Number 1 Region: 584-771
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-53
Family DBL homology domain (DH-domain) 0.00000000812
Further Details:      
 
Domain Number 2 Region: 776-915
Classification Level Classification E-value
Superfamily PH domain-like 1.92e-38
Family Pleckstrin-homology domain (PH domain) 0.00000017
Further Details:      
 
Domain Number 3 Region: 262-412
Classification Level Classification E-value
Superfamily Spectrin repeat 9.21e-17
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 4 Region: 1071-1127
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000503
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 5 Region: 29-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000968
Family CRAL/TRIO domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009352
Domain Number - Region: 423-513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00216
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009352   Gene: ENSCAFG00000006240   Transcript: ENSCAFT00000010082
Sequence length 1160
Comment pep:known_by_projection chromosome:CanFam3.1:22:60516552:60569037:1 gene:ENSCAFG00000006240 transcript:ENSCAFT00000010082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSHQMTRCLSALPADEIMHQDITPLCAADIQDQLKKRFAYLSGGRGQDGSPVITFPDYPA
FSDVPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASILRIAASFPANLQL
VLVLRPTGFFQRALSDLAFKFNRDDLKMKVPVIMLSSVPELHGYIDKSQLTEDLGGTLDY
CHTRWLCHRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDKAK
EDMRLALDEGKSILENIREPLAKSGEQSLNQDELDNQTTVQRLLAQLNETEAAFDEFWAK
HQQKLQQCLQLRHFEQDFREVKSSLDALAQKIATFTDVGNSLAHAEHLLKDLASFEEKSS
ASVKRAHTLSLEGEKLIDTKHYAVDSIRPKCHELQYLCDQFAAEVERRRGLLSKSLELHG
LLEASMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNKIYQDYE
SILTKDLMEHVQKVFQKQEGMEEMFHRRQASLKKLAAKQMRPVQPVAPRPEALTKSPCPS
PGSRRGSENSSEGSTLRRGPYRRAKSEASEGRQGRSSSTGHEEESLAVLRRHVMNELLDT
ERVYVEELLCVLEGYAAELDNPLMAHLMSPGLQNKKDILFGNMEEIYHFHNRIFLRELEE
YTDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQRKLDHKLSLDS
YLLKPVQRITKYQLLLKEMLKYSKSCEGAEDLQEALSSILGILKAVNDSMHLIAITGYDG
NLSDLGKLLMQGSFSVWTDHKKGHSKVKDLARFKPMQRHLFLHEKAVLFCKKREENGEGY
EKAPSYSYKQSLNMAAVGITENVKGDVRKFEIWYNAREEVYIVQAPTPEVKAAWVSEIRK
VLTSQLQACREASQHRTLEQSQSLPLPTPPSTSPSKGTTRNIKKLEERKTDPLSLEGYMS
PSSLPKPPEKGRDDMVTSSTSESSALSRKRFTLQGFANLKGQKASPTSPDKKPKRHEVKS
DPTPFGLRGWSKTSHPLEAPEDNDGWSSAEELMNSSDAEEEGRVGPRKLVPGKYTVVVDD
EKGSPEALAVRNGDMVEVVQEGDEGLWYVRNLTSSKESWVPASSLSALLGVSGSAQCLSS
SGKPRARAGRTPSPRGPAAA
Download sequence
Identical sequences F1PWX7
ENSCAFP00000009352 ENSCAFP00000009347 9615.ENSCAFP00000009352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]