SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009377 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009377
Domain Number 1 Region: 180-194,283-319,379-592
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-59
Family Nuclear receptor ligand-binding domain 0.000092
Further Details:      
 
Domain Number 2 Region: 112-193
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-29
Family Nuclear receptor 0.0000972
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009377   Gene: ENSCAFG00000006244   Transcript: ENSCAFT00000010109
Sequence length 605
Comment pep:known_by_projection chromosome:CanFam3.1:15:35003604:35038968:-1 gene:ENSCAFG00000006244 transcript:ENSCAFT00000010109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATIEEIAHQIIEQQMGEIVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSTPSKVILS
RQDSTPGKVFLTTPDAAGVNQLFFTTPDLSAQHLQLLTDNSSPDQGPNKVFDLCVVCGDK
ASGRHYGAVTCEGCKGFFKRSIRKNLVYSCRGSKDCIINKHHRNRCQYCRLQRCIAFGMR
QDSVQCERKPIEVSREKSSNCAASTEKIYIRKDLRSPLAATPTFVTDSETARSAGLLDSG
MFVNIHQSGIKTESTVLMTPDKAESCQGDLSTLASVVTSLANLGKTKALSQNSNEMSMIE
SLSNGDTSLCEFHQEMQTNGDVSRAFDTLAKALNPGESTACQNSVEGMEGSIHLIAGDSS
INYIEKEGPLLSDSHVAFRLTMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALG
QENSISLVKAYWNELFTLGLAQCWQVMNVATILATFVNCLHSSLQQDKMSTERRKLLMEH
IFKLQEFCNSMVKLCIDGYEYAYLKAIVLFSPDHPGLENMEQIEKFQEKAYVEFQDYITK
TYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQI
IGHSI
Download sequence
Identical sequences E2QX37
XP_013975037.1.84170 XP_013975038.1.84170 XP_854792.1.84170 ENSCAFP00000009377 ENSCAFP00000009377 9615.ENSCAFP00000009377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]