SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009388 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009388
Domain Number 1 Region: 2266-2566
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-128
Family BEACH domain 0.0000000000125
Further Details:      
 
Domain Number 2 Region: 212-403
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.62e-33
Family Clostridium neurotoxins, the second last domain 0.028
Further Details:      
 
Domain Number 3 Region: 2154-2261
Classification Level Classification E-value
Superfamily PH domain-like 3.63e-30
Family PreBEACH PH-like domain 0.00000224
Further Details:      
 
Domain Number 4 Region: 2683-2936
Classification Level Classification E-value
Superfamily WD40 repeat-like 4e-30
Family WD40-repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 495-602,681-977
Classification Level Classification E-value
Superfamily ARM repeat 2.35e-16
Family Plakophilin 1 helical region 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009388   Gene: ENSCAFG00000006255   Transcript: ENSCAFT00000010121
Sequence length 2949
Comment pep:known_by_projection chromosome:CanFam3.1:25:4856696:5537025:-1 gene:ENSCAFG00000006255 transcript:ENSCAFT00000010121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEKPGPGPGLEPQPVGLIAVGAGGGGGGGGGGGGGGGGGGGGGPGMGELRGASGSGSV
VLPAGMINPSVPIRNIRMKFAVLIGLIQVGEVSNRDIVETVLNLLVGGEFDLEMNFIIQD
AESITCMTELLEHCDVTCQAEIWSMFTAILRKSVRNLQTSTEVGLIEQVLLKMSAVDDMI
ADLLVDMLGVLASYSITVKELKLLFSMLRGESGIWPRHAVKLLSVLNQMPQRHGPDTFFN
FPGCSAAAIALPPIAKWPYQNGFTLNTWFRMDPLNNINVDKDKPYLYCFRTSKGVGYSAH
FVGNCLIVTSLKSKGKGFQHCVKYDFQPRKWYMISIVHIYNRWRNSEIRCYVNGQLVSYG
DMAWHVNTNDSYDKCFLGSSETADANRVFCGQLGAVYVFSEALNPAQIFAIHQLGPGYKS
TFKFKSESDIHLAEHHKQVLYDGKLASSIAFTYNAKATDAQLCLESSPKENASIFVHSPH
ALMLQDVKAIVTHSIHSAIHSIGGIQVLFPLFAQLDNRQLNDSQVETTVCATLLAFLVEL
LKSSVAMQEQMLGGKGFLVIGYLLEKSSRVHITRAVLEQFLSFAKYLDGLSHGAPLLKQL
CDHILFNPAIWIHTPAKVQLSLYTYLSAEFIGTATIYTTIRRVGTVLQLMHTLKYYYWVI
NPADSSGITPKGLDGPRPSQKEIISLRAFMLLFLKQLILKDRGVKEDELQSILNYLLTMH
EDENIHDVLQLLVALMSEHPASMIPAFDQRNGIRVIYKLLASKSESIWVQALKVLGYFLK
HLGHKRKVEIMHTHSLFTLLGERLMLHTNTVTVTTYNTLYEILTEQVCTQVVHKPHPEPD
STVKIQNPMILKVVATLLKNSTPSAELMEVRRLFLSDMIKLFSNSRENRRCLLQCSVWQD
WMFSLGYINPKNSEEQKITEMVYNIFRILLYHAIKYEWGGWRVWVDTLSIAHSKVTYEAH
KEYLAKMYEEYQRQEEENIKKGKKGNVSTISGLSSQTTGAKGGLEIREIEDLSQSQSPES
ETDYPVSTDTRDLLMSTKVSDDILGNSDRPGSGVHVEVHDLLVDIKAEKVEATEVKLDDM
DLSPETLVGGENGALVEVESLLDNVYSAAVEKLQNNVHGSVGIIKKNEEKDNGPLITLAD
EKDELPNSSTSFLFDKIPKQEEKLLPELSSNHIIPNIQDTQVHLGVNDDLGLLAHMTSSV
DLGCASSIIEEKEFKIHTTSDGMSSISERDLASSSKGLEYAEMTATTLETESSGSKTVPN
IDAGSIISDTERSDDGKESGKEIRKIQTTATTQAVQGRSITQQDRDLRVDLGFRGMPMTE
EQRRQFSPGPRTTMFRIPEFKWSPMHQRLLTDLLFALETDVHVWRSHSTKSVMDFVNSNE
NIIFVHNTIHLISQMVDNIIIACGGILPLLSAATSPTTELENIEVTQGMSAETAVTFLSR
LMAMVDVLVFASSLNFSEIEAEKNMSSGGLMRQCLRLVCCVAVRNCLECRQRQRDRGSKS
SHGSSKPQEAPQSVTATAASKTPLESVPGNLSPIKDPDRLLQDVDINRLRAVVFRDVDDS
KQAQFLALAVVYFISVLMVSKYRDILEPQRETARTGSQPGRNIRQEINSPTSTVVVIPSI
PHPSLNHGFLAKLIPEQSFAHSFYKETPATFPDTIKEKETPTPGEDIQLESSIPHTDSGI
GEEQVASILNGAELETGTGPDAMSELLSTLSSEVKKSQESLTENPSELLKPAPSISSISQ
TKGINVKEILKSLVAAPVEIAECGPEPIPYPDPALKREAQAILPMQFHSFDRSVVVPVKK
PPPGSLAVTTVGATAAGSGLATGSTSNIFAATGATPKSMINTTGAVDSGSSSSSSSSSFV
NGATSKNLPAVQTVAPMPEDSAENMSITAKLERALEKVAPLLREIFVDFAPFLSRTLLGS
HGQELLIEGLVCMKSSTSVVELVMLLCSQEWQNSIQKNAGLAFIELINEGRLLCHAMKDH
IVRVANEAEFILNRQRAEDVHKHAEFESQCAQYAADRREEEKMCDHLISAAKHRDHVTAN
QLKQKILNILTNKHGAWGAVSHSQLHDFWRLDYWEDDLRRRRRFVRNAFGSTHAEALLKA
AVEYGTEEDVVKSKKTFRSQAIVNQNAETELMLEGDDDAVSLLQEKEIDNLAGPVVLSTP
AQLIAPVVVAKGTLSITTTEIYFEVDEDDPAFKKIDTKVLAYTEGLHGKWMFSEIRAVFS
RRYLLQNTALEVFMANRTSVMFNFPDQATVKKVVYSLPRVGVGTSYGLPQARRISLATPR
QLYKSSNMTQRWQRREISNFEYLMFLNTIAGRTYNDLNQYPVFPWVLTNYESEELDLTLP
GNFRDLSKPIGALNPKRAVFYAERYETWEDDQSPPYHYNTHYSTATSTLSWLVRIEPFTT
FFLNANDGKFDHPDRTFSSVARSWRTSQRDTSDVKELIPEFYYLPEMFVNSNGYNLGVRE
DEVVVNDVGLPPWAKKPEDFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAVRALNV
FHYLTYEGSVNLDSITDPVLREAMEAQIQNFGQTPSQLLIEPHPPRSSAMHLCFLPQSPL
MFKDQMQQDVIMVLKFPSNSPVTHVAANTLPHLTIPAVVTVTCSRLFAVNRWHNTVGLRG
APGYSLDQAHHLPIEMDPLIANNSGVNKRQITDLVDQSIQINAHCFVVTADNRYILICGF
WDKSFRVYSTETGKLTQIVFGHWDVVTCLARSESYIGGDCYIVSGSRDATLLLWYWSGRH
HIIGDNPNSSDYPAPRAVLTGHDHEVVCVSVCAELGLVISGAKEGPCLVHTITGDLLRAL
EGPENCLFPRLISVSSEGHCIIYYERGRFSNFSINGKLLAQMEINDSTRAILLSSDGQNL
VTGGDNGVVEVWQACDFKQLYIYPGCDAGIRAMDLSHDQRTLITGMASGSIVAFNIDFNR
WHYEHQNRY
Download sequence
Identical sequences E2QWB6
ENSCAFP00000009388 ENSCAFP00000009388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]