SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009426 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009426
Domain Number 1 Region: 6-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-76
Family BAR domain 0.0057
Further Details:      
 
Domain Number 2 Region: 392-571
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000166
Further Details:      
 
Domain Number 3 Region: 265-365
Classification Level Classification E-value
Superfamily PH domain-like 1.4e-18
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 704-759
Classification Level Classification E-value
Superfamily SH3-domain 7.09e-17
Family SH3-domain 0.0000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009426   Gene: ENSCAFG00000006266   Transcript: ENSCAFT00000010160
Sequence length 760
Comment pep:known_by_projection chromosome:CanFam3.1:2:37627422:38039759:1 gene:ENSCAFG00000006266 transcript:ENSCAFT00000010160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPALEFSDCCLDSPHFRETLKSHEAELDKTNKFIKELIKDGKSLIGALKNLSLAKRKF
ADSLNEFKFQCIGDAETDDEMCIARSLQEFATVLRNLEDERIRMIENASEVLITPLEKFR
KEQIGAAKEAKKKYDKETEKYCGILEKHLNLSSKKKESQLQEADSQVDLVRQHFYEVSLE
YVFKVQEVQERKMFEFVEPLLAFLQGLFTFYHHGYELAKDFSDFKTELTISIQNTRNRFE
GTRSEVESLMKKMKENPLEHKTISPYTMEGYLYVQEKRHFGTSWVKHYCTYQRDSKQITM
VPFDQKSGGKGGEDESVTLKSCTRRKTDSIEKRFCFDVEAVDRPGVITMQALSEEDRRLW
MEAMDGREPVYNSNKDSQSEGTAQLDSIGFSIIKKCIHAVETRGINEQGLYRIVGVNSRV
QKLLSVLMDPKTASETETDICAEWEIKTITSALKTYLRMLPGPLMMYQFQRSFIKAAKLE
NQESRVSEIHSLVHRLPEKNRQMLQLLMNHLANVANNHKQNLMTVANLGVVFGPTLLRPQ
EETVAAIMDIKFQNIVIEILIENHEKIFNTVPDMPLTNAQLHLSRKKSSDSKPPSCSERP
LTLFHAMQSAEKQEQRNSIINSSLESVVSSNANSILNSSSSLQPNMNSSDPDLDVLKPAR
PKSLPPNPSPTSPLSPSWPMFSAPSSPMPTSSTSSDSSPISTPFRKAKALYACKAEHDSE
LSFTAGTVFDNVHPSQEPGWLEGTLNGKTGLIPENYVEFL
Download sequence
Identical sequences F1Q2M8
ENSCAFP00000009426 ENSCAFP00000009426 XP_003433821.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]