SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009512 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009512
Domain Number 1 Region: 544-1020
Classification Level Classification E-value
Superfamily Ras GEF 8.37e-142
Family Ras GEF 0.0000000000000112
Further Details:      
 
Domain Number 2 Region: 5-154
Classification Level Classification E-value
Superfamily Histone-fold 7.75e-51
Family TBP-associated factors, TAFs 0.000000305
Further Details:      
 
Domain Number 3 Region: 175-377
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 4 Region: 395-550
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-39
Family Pleckstrin-homology domain (PH domain) 0.000000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009512   Gene: ENSCAFG00000006340   Transcript: ENSCAFT00000010257
Sequence length 1310
Comment pep:known_by_projection chromosome:CanFam3.1:17:31009903:31084663:-1 gene:ENSCAFG00000006340 transcript:ENSCAFT00000010257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPPKKQVQGQVHPTLESSDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPID
KWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILK
LVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYD
LVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHI
EDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALY
LQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNV
QSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNE
FIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQIND
KDDTSEYKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEK
EEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPIIKAGTVIKLIERLTYHMYADPNF
VRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQ
PVQLRVLNVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIA
RDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSE
LVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQ
ELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSIN
PPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRV
ESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPS
NPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCS
VFDSDHSSPFHSSSDTVFIQVSLPHGPRSASVSSISLTKGTDEVPVPPPVPPRRRPESAP
AESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISDRTSISDPPESPPLLPPREPVRTP
DVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEAD
LPSVTGPPVPPRQSTSQHIPKLPPKTYKREHTHPSVHRDGPPLLENAHSS
Download sequence
Identical sequences F1Q118
ENSCAFP00000009512 ENSCAFP00000009512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]