SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009615 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009615
Domain Number 1 Region: 338-503
Classification Level Classification E-value
Superfamily PH domain-like 2.24e-35
Family Phosphotyrosine-binding domain (PTB) 0.0061
Further Details:      
 
Domain Number 2 Region: 526-657
Classification Level Classification E-value
Superfamily PH domain-like 7.79e-33
Family Phosphotyrosine-binding domain (PTB) 0.0000119
Further Details:      
 
Domain Number 3 Region: 243-284
Classification Level Classification E-value
Superfamily WW domain 0.000000000115
Family WW domain 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009615   Gene: ENSCAFG00000006420   Transcript: ENSCAFT00000010371
Sequence length 707
Comment pep:known_by_projection chromosome:CanFam3.1:21:29719793:29734323:-1 gene:ENSCAFG00000006420 transcript:ENSCAFT00000010371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPSSLSQSAINANSHGGPALSLPLPLHTAHNQLLNSKLQATAVGPKDLRSAMGEGGGP
EPGPANAKWLKEGQNQLRRAATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLMHLYSEL
ELSAHNAANRGLRGSGLIISTQEHGPDEGEEKAAGEAEEDDEEEDEEEEEEDLSSPQGLP
EPPESVEVPPRPQALADGPREHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT
DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQWEPPGRASPSQGSSPQEESQL
TWTGFAHREGFEDGEFWKDEPSEEAPMDLGLKDTEEGALPFPAQSLSPEPLPQEEEKLPP
RNANPGIKCFAVRSLGWVEMTEEELAPGHSSVAVNNCIRQLSYHKNNLHDPMSGGWGEGK
DLLLQLEDETLKLVEPQSQALLHAQPIVSIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF
RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSKLVDVPFQVEFPAPKNELVQK
FQVYYLGNVPVAKPVGVDVINGALESVLSSSSREQWTPSHVSVAATLTILHQQTEAVLGE
CRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPNAASLSEAVQAACMLRYQKCLD
ARSQASTSCLPAPPAESVARRVGWTVRRGVQSLWGSLKPKRLGAHTP
Download sequence
Identical sequences E2QWV4
ENSCAFP00000009615 ENSCAFP00000009615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]