SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009625 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009625
Domain Number 1 Region: 14-76
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000645
Family SNARE fusion complex 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009625   Gene: ENSCAFG00000006433   Transcript: ENSCAFT00000010382
Sequence length 111
Comment pep:known_by_projection chromosome:CanFam3.1:18:25360636:25361857:-1 gene:ENSCAFG00000006433 transcript:ENSCAFT00000010382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADWARAQSPAAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDSMDSDF
TSMTGLLTGSVKRFSTMARSGRDNRKLLCGMALGLIVVFFILSYLLSRART
Download sequence
Identical sequences E2QW29
ENSCAFP00000009625 XP_540512.2.84170 9615.ENSCAFP00000009625 ENSCAFP00000009625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]