SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009656 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCAFP00000009656
Domain Number - Region: 149-187
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0516
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 
Domain Number - Region: 316-391
Classification Level Classification E-value
Superfamily RbcX-like 0.0765
Family RbcX-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009656   Gene: ENSCAFG00000006413   Transcript: ENSCAFT00000010414
Sequence length 877
Comment pep:known_by_projection chromosome:CanFam3.1:27:805659:843695:-1 gene:ENSCAFG00000006413 transcript:ENSCAFT00000010414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWIIIGFLLCNGCLNSNSQCQKLWKLCLQGSLYITLIREDVLQVHKVTEDLFSSWKGY
GKRVADIKESKEHVIANSGQFHCQRRQFLRMAVKELETVLTDEPGLLGPKALYVFMALSF
IRDEVTWLVRHTENVTKTKTPEDYADSSIAELLFLLEEIRALVRRHIKVIQQYHLQYLAR
FDALVLSDIIQNLSVCPEEESIIMSSFVSTLSSLNLKQVDSGEKFEFSGLRLDWFRLQAY
TSVAKAPLHLHENPDLAKVMNLIVFHSRMLDSVEKVLVETSDLSTFCFHLRTFEKMFTMT
LEEPTMLRYAIAFPLICAHFVHCTHEMCPEEYPHLKNHSLHHCNSFLEELAKQTSNCVLE
ICAEQRNLSEQLLPKHCATTISKAKNKKMKQKQTPRKGEPERDKPGAESHRKNRSIVTNM
DKLHLHLTELALTMNHVHSFSVFEHTIFPSEYLSSHLEARLNRAIVWLAGYNAATQEIAR
PSELLAGVKAYISFIQSLAQFVGADVSRVIRNALLQQTQPLDSCGEQTITTLYTNWYLEG
LLRQASSGTITLAPAMQAFVSLPREGEQNFSAEEFSDVSEMRALAELLGPYGMKFLSENL
MWHVTSQIVELKKLVVENMDVLVQIRSNFSKADLMASLLPQLTGADNVLKRMTIIGVILT
FRAMAQEGLREVFSSHCPFLMGPIECLKEFVTADTDIKVTLSIFELASAAGVGCDIDPAL
VAAIANLKADTSSPEEEYKVACLLLVFLAASLPLLATDPASFFSIEKDGYNNNIHCLTKA
IIQVSAALFTLYNKNIETHLKEFLVVASVSLLQLGQETDKLKTRNRESISLLMRLVVEES
SFLTLDMLESCFPYVLLRNAYREVSRAFYLNRVAAST
Download sequence
Identical sequences F6Y250
ENSCAFP00000039176 ENSCAFP00000009656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]