SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009674 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009674
Domain Number 1 Region: 6-35
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000417
Family CHHC finger 0.008
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009674
Domain Number - Region: 39-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0714
Family CHHC finger 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009674   Gene: ENSCAFG00000006463   Transcript: ENSCAFT00000010432
Sequence length 155
Comment pep:novel chromosome:CanFam3.1:27:848200:851211:1 gene:ENSCAFG00000006463 transcript:ENSCAFT00000010432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METEALERCPYDPNHRMPASRLQYHLASCRKKNLKIAKKMANCKYNACHVVPIKRLKEHE
VNCVNRTAVDDEPFNLPKFISPSLEPNKKLSNTANQIFDPNVWNIDNTHHSPSFVLKTFV
PKMLVCESDSRDIKKETMDDKHPNNVKSWRKGRKN
Download sequence
Identical sequences E2QV24
ENSCAFP00000009674 ENSCAFP00000009674 9615.ENSCAFP00000009674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]