SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009695 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009695
Domain Number 1 Region: 297-619
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.67e-88
Family p120GAP domain-like 0.0000669
Further Details:      
 
Domain Number 2 Region: 577-713
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-47
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 
Domain Number 3 Region: 146-307
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.1e-27
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Domain Number 4 Region: 14-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.48e-24
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009695   Gene: ENSCAFG00000006458   Transcript: ENSCAFT00000010454
Sequence length 834
Comment pep:known_by_projection chromosome:CanFam3.1:22:61094914:61202106:-1 gene:ENSCAFG00000006458 transcript:ENSCAFT00000010454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVEEEGLRVFQSVKIKIGEAKNLPTYPGPNKMRDCYCTVNLDREEVFRTKIVEKSLCPF
YGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLPKYHNRDTWFQLQHVDAD
SEVQGKVHLELRLSEVITDTGVVCHKLAARILECQGLPIVNGQCDPYATVTLAGPYRSEA
KKTKVKKKTNNPQFDEVFYFEVTRPCSYNRKSHFDFEEEDVDKLEIRVDLWNASNLKFGD
EFLGELRVPLNVLRQSSSYEAWYFLQPRDNGSKSLKPGDLGSLRLNVVYTEDHVFSSDYY
SPLRDLLLRSADVEPVSASAAHVLGEVCREKQEAAIPLVRLFLHYGRVVPFISAIANAEV
RRTQDPNTIFRGNSLTSKCIDETMKLAGMHYLHMTLKPAIEEICQSHKSCEIDPVKLKDG
ESLENNMENLRQYVDRIFNVITKSGVSCPTVMCDIFFSLREAAAKRFQDDLDVRYTAVSS
FIFLRFFAPAILSPNLFQLTPHHTDPQTSRTLTLISKTIQTLGSLSKSKSASFKESYMAA
FYEFFNEQKYADAVKNFLDLISSSGRRDPKSIEQPILLKEGFMIKRAQGRKRFGMKNFKK
RWFCLTNHEFTYQKSKGDQPLCSIPIENILAVEKLEEESFKMKNMFQVIQPERALYIQAN
NCVEAKAWIDILTKVSQCNQKRLTVYHPSAYLNGHWLCCRASSDTAPGCSPCTGGLPANI
QLDIDGDRETERIYSLFNSYMSKLEKMQEACGSRSVYDGPEQEEYSTFIIDDPQETYKTL
KQVITGVGALEQEHAQYRRDKFKKTKYGSQEHPIGDKSFQSYIRQQSETSTHSI
Download sequence
Identical sequences E2QUY1
ENSCAFP00000009695 XP_005634195.1.84170 ENSCAFP00000009695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]