SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009866 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009866
Domain Number 1 Region: 2537-2823
Classification Level Classification E-value
Superfamily BEACH domain 1.96e-121
Family BEACH domain 0.0000000457
Further Details:      
 
Domain Number 2 Region: 2909-3107,3137-3185
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.89e-29
Family WD40-repeat 0.0016
Further Details:      
 
Domain Number 3 Region: 2390-2515
Classification Level Classification E-value
Superfamily PH domain-like 2.64e-18
Family PreBEACH PH-like domain 0.018
Further Details:      
 
Domain Number 4 Region: 473-727,822-888
Classification Level Classification E-value
Superfamily ARM repeat 0.00000137
Family MIF4G domain-like 0.085
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000009866
Domain Number - Region: 146-456
Classification Level Classification E-value
Superfamily ARM repeat 0.000153
Family Armadillo repeat 0.084
Further Details:      
 
Domain Number - Region: 1153-1226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00116
Family Glycosyl hydrolases family 16 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009866   Gene: ENSCAFG00000006576   Transcript: ENSCAFT00000010643
Sequence length 3186
Comment pep:known_by_projection chromosome:CanFam3.1:28:632300:900468:1 gene:ENSCAFG00000006576 transcript:ENSCAFT00000010643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEGVSRAEDRAEYPGSKNEGQPDVAQPDFPHGEQSPGPTALWEMLERKFLEYQQLAHG
SPAEHQQSLLNLLPLFLKAWENSVGIISFPSLQRLAQDTSNQLAQEIQKALVGKPAEQAR
EAAWQLLRWKGNVDQDGYLLLKSVFVLTGTNSETLGKVAESGLPALLLQCLYLFFVFPLE
KDELFESDVQIQRMFVQMLLNICNESQGLERLLSGNELQSLVIATTCLREHSCCSWKEPT
FCVLRAISKAQNLGIIQYLQVMDCIKLSIQNLSKLAESLPTPEVSEAVNLILGFVKDSYP
VSSALFLEFENGEGYPLILKVLLRYDGLTQSEVDPHLEELLELLMWLTTCGRSELKVFDS
VMYPQLEGFKFHHEASGVTVKNLQAFQVLQNVFHKASSPALCTKVLSAIRTMWSWNARNF
FLLEWTLQPISQFVEIVPRKPAPVQKYFFQLLEALVFELHYVPHEILRKVQCLIKESPES
PCTLVALQSVLRIASRDLLFTDIFRDSGLLGLLLAQLRKRAKILRKSGNKESMLGVQDTE
RELTCVMLRTVVMLLRGSVRNAVVLKDHGMVPFIKIFLDDGWYREASLSILEQLSLINAE
EYMSIIVGALCSSTQGELQLKLDLLQSLLRILETPKGRAAFRVSSGFNGLLSLLSDLEGS
LQEPPLQTWGMVAPSQTLDLVLHTLCALSAALYLDPVNSDFFKKNGLFEKLAEDLCLLGC
FGAQEEEEAPLPSRVDTKARPFADLLSMAFTSASPLPRKIQSCLQILSFLDSMVDGTLHL
RRDLKGSPRAGKDPVVNAQKEDAGSDPQGNVKRWPDLEERVDEGDAVIMHPGILCIMVRL
LPWLYHADHPQLSQEIQCSMASHIQSLVKSEKNRQVMCEAGMLRTLVASCRRALTASPSP
LNLGLIRIFEKLASQAIEPDVLRQFLGLGMPPLPSAAVNILHLSFVNRGDSGGSGSQAIA
AGTAEGPTGTVLDAGPCSAVTQTIRPSGTSQGSATALQTSMSLISMTSPRNLQPQRAALA
PSFVEFDMSVEGYGCLFIPTLSTVMGSSTEYLVSGGIGTGAARSFPPPRGLTFSCWFLIG
RHSTVTEGHPLRFLSLVRHLARTEQPFVCFSVSLCLDDFSLVVSTEEKEFQPLDVMEPED
DPEPSAGRQLRVRCGQLLACGQWHHLAVVVTKEMKRNCTVSTYLDGQITGSAKMLYIQAL
PGPFLSMDPSSFVDVYGYISTPRIWKQKSSLIWRLGPTYLFEEAISMDTLEVINKLGPRY
CGNFQAVHAQGLDLDVEAMPLVAEERVSFGLHVASSSITSVTDIRNTYSEVDSRLIAKEM
NISSRDSTMPVFLLRNCAGHLSGSLRTVGAVAVGHLGIRVFHSIPAASSLDFIGGPAILL
GLISLATDDHTMYAAIKVLHSVLTSNVMCDHLMQHIRGYQIMAFLLRKKTSLLNHRIFQL
IISIAGTAELGFGSSAVTNVGVFRHILCNFELWMNTADNLELSLFSHLVEILRSPREGPR
NAEVAHQAQLIPKLIFLFNEPGLTFSKIPTIIAILGCQLRGHFNIQDLLRIGLFVVYTLK
PSSVNEREICVDGGLDSSVPAGSQTSGKTIWLRNQLLEMLFSVISSSQLHLSSETKEEMF
LNLGPDWFLLLVQGHVHPSTTVLGLKLLLHFLSSPSLQGRFKDGLSAGSWVEHSSEGVDI
VIDNLKSQPPMPDQSPCLLPGFRVLKDFLSHHVHIPEVYLIVSTFFLQTPLTELMDGPKD
RLDAMLRWLLQKHHSEEVLRAGLCTEGALLLLEMLKATMNQPSAGSGDDAWEQTFPASVL
QFLGLVHSTYPQDPAWRAPEFLQMLAAVTFPLGTHKEPMTQPAQNASSPGAEADRDGIAE
HLQAPAKSHPTRKQLREFMQLLLREFLLEASNPKQWLPLEVLLEAFPDSATSQQKRDFQS
EILLSTMEIFHTMSGGNVPLLRDSKEPQPNAEAAAAPSLANISHFTQKLVEKLCSGMFSA
DPRHILLFIIDHIMVVIENASSQKDAVISALYSSLNKVILYCLSKPQQSLSECLGLLSIL
GFLQEHWDIIFATYNSNISFLLCLMHCFLLLSERSYPEGFGLEPKPRMTPYHQVFLSSNE
EVREKGEEDFPSLNDVQNNIQKMVRTLWQQLVAQRRQELEDTFKIDLSVKPGESEVKIEE
ITPLWEETMLKAWQHYLASEKKSLSNRSNVGHHSKVSSWSGSLSSAMRLMPGRQAKEPEW
KTEDFVSCIENYRRRGQELYASLYKDHVQRRRCDNIKAANAWARIQEQLFGELGLWGQTA
EATLCSRWELDWREGPARMRKRVRRLSPLEALSPERFKVRLRWSKTIVCSLYAAVDELTP
EEAESRRDEVAVDCTQLTFFPALHESLHSEDFLELCQERQVILQELLDHEKVTQKYSLVI
VQGHLVSEGVLLFGHQHFYICENFTLSPVGDVYCTRHCLSNISDPFIFNMCSKDRSSDQY
SCQSHSYGQLSELRQARFLLQDIALELFFQNGYSKFLVFHNNDRSKVFKSFCSFQPSLKG
KGITEDPLNLRRYPGSDRTMLQRWQKRDISNFEYLMYLNTVAGRTYNDYMQYPVFPWVLA
DYTSQTLNLMNPKTFRDLSKPMGAQTKERKLKFIQRFKEVEKTEGDMTVQCHYYTHYSSA
IIVASYLVRMPPYTQAFCSLQGGSFDVADRMFHSVKNTWESASRDNMSDVRELTPEFFYL
PEFLINCNGVEFGCMQDGTALGDVQLPPWADGDPRKFISLHRQALESDFVSANLHHWIDL
IFGYKQQGSAAVEAVNTFHPYFYGDKMDLSSISDPLIRSTILGFVSNFGQVPKQLFTKPH
PARTVAGKPSPGKDAVVPASLPSHPQPFFYNLQALKPSQVTVKDMYLFSLGSESPKGAIG
HIVPTEKTILAVEKNKVLLPPLWNRTFSWGFDDFSCCLGNYGSDKIIMTFENLAAWGRCL
CTVCPTPTMIITSGASTVVCVWELSIAKGRPRSLHLKQALYGHTQAVTCLAASVIFSLLV
SGSQDCTCILWDLDHLTHVARLPTHQEGISALAISDVSGTIVSCAGAHLSLWNVNGQPLA
SITTAWGPEGAITCCYVMEGPAWDTNHVIITGSQDGMVRIWRTEDMKTSVPGLTIPEEPS
AQPPSPRGHRWEKNLALCRELDVSLALTGKPSKTSPAVTALAVSRNQIKLLVGDEKGRIF
CWSAEG
Download sequence
Identical sequences F1Q3G0
ENSCAFP00000009866 ENSCAFP00000009866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]