SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009942 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009942
Domain Number 1 Region: 8-272
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.89e-60
Family Ankyrin repeat 0.0000487
Further Details:      
 
Domain Number 2 Region: 1025-1186
Classification Level Classification E-value
Superfamily PH domain-like 5.04e-48
Family Phosphotyrosine-binding domain (PTB) 0.002
Further Details:      
 
Domain Number 3 Region: 806-877
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.55e-18
Family SAM (sterile alpha motif) domain 0.0069
Further Details:      
 
Domain Number 4 Region: 880-943
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.46e-16
Family SAM (sterile alpha motif) domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009942   Gene: ENSCAFG00000006596   Transcript: ENSCAFT00000010724
Sequence length 1256
Comment pep:known_by_projection chromosome:CanFam3.1:15:38129189:39186359:-1 gene:ENSCAFG00000006596 transcript:ENSCAFT00000010724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSAALEEHVQE
DTTQEIHISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP
ILAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLTDIAVTKKPCSLEIARAPSPRTD
NASEVAITAPGNSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHR
MNHNQEYFEINTSAGCASFTSSPPISPPTSSVGTTEVKNEGTGHTDDPSQQEESDPPKEY
DPGQFAGLLHGSSPACESPENPFHLYGKRDEHEVGQDEVSLANSPLPFKKSPIANNSETV
VKKIKPKVVSRTIFHKKSNQLENHTIVGTRTTRSGSRNGDQWIVNTGGFVERACTLGRIR
SLPKALIDMHLSKNVSKSDSDLIAYPSTEKTSRVNWSESSTAEHSSKGNSERTPSFTSEW
EEIDKIMNSIDVGINSELEEMNSETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGD
YTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSIT
LRDPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQM
AQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDPEDLS
TFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSSTLPES
FENKPSKPIPKPRVSIRKSVQIDPSEQKTLANLPWIVEPGQEAKRGINTKYETTIF
Download sequence
Identical sequences F1PTK2
ENSCAFP00000009942 ENSCAFP00000009942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]