SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000009960 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000009960
Domain Number 1 Region: 655-945
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.48e-69
Family Ankyrin repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 186-476
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.56e-66
Family Ankyrin repeat 0.000012
Further Details:      
 
Domain Number 3 Region: 1106-1309
Classification Level Classification E-value
Superfamily ADP-ribosylation 2.4e-38
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.002
Further Details:      
 
Domain Number 4 Region: 514-714
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-37
Family Ankyrin repeat 0.00037
Further Details:      
 
Domain Number 5 Region: 1027-1088
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000334
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000009960   Gene: ENSCAFG00000006632   Transcript: ENSCAFT00000010746
Sequence length 1327
Comment pep:known_by_projection chromosome:CanFam3.1:16:34831826:35040344:-1 gene:ENSCAFG00000006632 transcript:ENSCAFT00000010746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGTTPASPTAGGLAPFASPR
HGLALPEGDGSRDPPDRPRSPEPVDSTSCCSTTSTICTVAAAPVAPAVSASSAVGVAPNP
AGGGSNNSPSSSSSPTSSSSSSPSSPGSSLAESPEAAGVSTTATLGPGAAGPGPGVPAVS
GALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRKDVVEHLLQMGA
NVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIV
LLQHGADPNIRNTDGKSALDLADSSAKAVLTGEYKKDELLEAARSGNEEKLMALLTPLNV
NCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTEL
LLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPEL
RERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQV
TELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAAL
AGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSESTPIRTSDVDYRLLEASKA
GDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYLLHHGADVHAKDKGGLVP
LHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKN
RDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLCTPENINCRDTQGRNSTP
LHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATD
KWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLIDAMPPEA
LPTCFKPQATVVSASLISPASTPSCLSAASSIDNLTGPLAELAVGGASNTGDGAAGTERK
EGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMGHEELKEIGINAYGHRHKLI
KGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPEDKEYQSVEEEMQSTIREHRDGGNAGG
IFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERMLFHGSPFINAIIHKGFDER
HAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRSCYICHRQMLFCRVTLGKSF
LQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEAPAQTA
TAAEQKT
Download sequence
Identical sequences E2QU22
XP_849388.1.84170 ENSCAFP00000009960 9615.ENSCAFP00000009960 ENSCAFP00000009960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]