SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010009 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010009
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-24
Family PDZ domain 0.0019
Further Details:      
 
Domain Number 2 Region: 181-264
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000336
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 279-389
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000142
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010009   Gene: ENSCAFG00000006708   Transcript: ENSCAFT00000010804
Sequence length 517
Comment pep:known_by_projection chromosome:CanFam3.1:29:2523061:2822250:1 gene:ENSCAFG00000006708 transcript:ENSCAFT00000010804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFRTACEETKTGICLLQDGNQEPFKVRLHLAKDILMIQEQDVICVSGEPFYSGERTVTI
RRQTVGGFGLSIKGGAEHNIPVVISKISKEQRAELSGLLFIGDAILQINGINVRKCRHEE
VVQVLRNAGEEVTLTVSFLKRAPAFLKLPLNEDCACAPSDQSSGTSSPLCDSGLHLNYHP
NNTDTLSCSSWPTSPGLRWEKRWCDLRLIPLLHSRFSQYVPGTDLSRQNAFQVIAVDGVC
SGIIQCLSAEDCIDWLQAIATNISNLTKHNIKKINRNFPVNQQIVYMGWCEAREQDPLQD
RAYSPTFLALRGSCLYKFLAPPVTTWDWTRAEKTFSVYEIMCKILKDSDLLDRRKHCFTV
QSESGEDLYFSVELDSDLAQWERAFQTATFLEVERIQCKTYACVLESHLMGLTIDFSTGF
ICFDAATKAILWRYKFSQLKGSSDDGKSKIKFLFQNPDTKQIEAKELEFSNLFAVLHCIH
SFFAAKVACLDPLYLGNQTAASTAASSSTTSRAKYTT
Download sequence
Identical sequences F1PKW0
ENSCAFP00000010009 XP_005638018.1.84170 XP_013964784.1.84170 XP_013964785.1.84170 XP_013964786.1.84170 ENSCAFP00000010009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]