SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010023 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010023
Domain Number 1 Region: 969-1046
Classification Level Classification E-value
Superfamily SH3-domain 1.08e-20
Family SH3-domain 0.00035
Further Details:      
 
Domain Number 2 Region: 176-254
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-20
Family SH3-domain 0.00000476
Further Details:      
 
Domain Number 3 Region: 866-945
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000119
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 315-473
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000242
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 5 Region: 495-607
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000276
Family Fibronectin type III 0.00000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010023   Gene: ENSCAFG00000006721   Transcript: ENSCAFT00000010818
Sequence length 1128
Comment pep:known_by_projection chromosome:CanFam3.1:26:1672021:1744841:1 gene:ENSCAFG00000006721 transcript:ENSCAFT00000010818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MREAAERRQQLELEHEQALAVLHAKQQEIELLQKAQVEAKKEHEGAVQLLESKVRELEEK
CRTQSEQFSLLSQDLEKLRQHAGKIDLLGGSAGASLDVLASGKPFSQFMNGLAPSIGKGQ
ESTLGSHTVIGDYLRPLPLPSDKPEPLSNKPAFLLRPASPRCRFESDMDNERNSSTSKQR
YSGKVHLCVARYSYNPFDGPNENPEAELPLTAGKYLYVYGDMDEDGFYEGELLDGQRGLV
PSNFVDFVQDSESRLASTLGSEQDQNLINHSSIGLEGENILDLHASTHIDTGLTDDGAGT
LGVNVDEIGEDIVPYPRKITLIKQLARSVIVAWDPPAVPPGWGTVSCYNVLVDQETRVSL
TLGSRTKALIEKLNTAACTYRISVQCITSRGSSDELQCTLLVGKDVVVAPSHLRVDNITQ
ISAQLSWLPTNSNYSHVIFLNEEELDVVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQ
LPLEQREKKEAFVEFSTLPAGPPAPPQDVTVHPGATPATIQVSWKPPALTTAGLSNGANV
SGYGVYAKGQRVAEVISPMADSIAVEVVRLRSLEAKGVTVRTLSAQGESTDSTTAAIPPD
LLVPPTPHPRTAPTPKPLASVGALETKDEHLGPHITVDEAWEQGRAPAPVHGHMLEPPSL
QGSGPGRRSPSPSRILPQPQGTPVSTSVAKAMAREAAQRVAESSRLEKRSIFLERGSGQY
MNSDEEDSYDSPDIKRRGASVDDFLKGSELGKQPHCCHGDEYHTESSRGSDLSDIMEEDE
EELYSEMQLEDGGRRRPSGTSHNALKILGNPVSAGRADRADHVGRRFSPGSAGPQRSRPM
MVPSIDEYSERDHLSPDFYEESETDPGAEELPARIFVALFDYDPLTMSPNPDAAEEELPF
KEGQIIKVYGDKDADGFYRGETCARLGLIPCNMVSEIQADDEEMMDQLLRQGFLPLNTPV
EKIERSRRSSRQPRVTRRVVALYDYDPRESSPNIDVEAELTFCTGDIITVFGEIDEDGFY
YGELNGQKGLVPSNFLEEVPDDVEVYLSDVPCHYPRDTLVRSKAKRVPPEGSGTARRAPS
PTAHLHSGSPPSSMGTGSPGRGREMSSKKKKGLLSRGKKLLKKLGAVK
Download sequence
Identical sequences E2RIE2
ENSCAFP00000010023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]