SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010076 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010076
Domain Number 1 Region: 63-168
Classification Level Classification E-value
Superfamily Cyclin-like 1.81e-32
Family Cyclin 0.001
Further Details:      
 
Domain Number 2 Region: 172-262
Classification Level Classification E-value
Superfamily Cyclin-like 0.00000000115
Family Cyclin 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010076   Gene: ENSCAFG00000006753   Transcript: ENSCAFT00000010874
Sequence length 290
Comment pep:known_by_projection chromosome:CanFam3.1:2:42587516:42588893:-1 gene:ENSCAFG00000006753 transcript:ENSCAFT00000010874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCIHTRRRARYEPDHRFGRSSAVPVFPSLQHIEVFLFCLVPQGRSLSFLDWFLLRALLPC
PPMSPRQVTAESRCKLLSWLIPVHRQFRLSFESLCLTVNTLDRFLTTTPVAADCFQLLGV
TSLLIACKQVEVHPPRVKQLLALCCGAFSRQQLCNLECIVLHKLHFSLGAPTISFFLEHF
THARVEAGQAEVSEALEAQALARGVAELSLADYAFTSYTPSLLAICCLALADRMLQLPRP
VDLRLGGHPEAALQDCLGKLQLLVAINEASLTHMLPFQIREKCSLSPKLK
Download sequence
Identical sequences E2RI76
ENSCAFP00000010076 ENSCAFP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]