SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010517 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010517
Domain Number 1 Region: 123-503
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.67e-146
Family Myotubularin-like phosphatases 0.0000000234
Further Details:      
 
Domain Number 2 Region: 6-112
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-17
Family GRAM domain 0.044
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000010517
Domain Number - Region: 495-542
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0233
Family MED7 hinge region 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010517   Gene: ENSCAFG00000007083   Transcript: ENSCAFT00000011353
Sequence length 621
Comment pep:known_by_projection chromosome:CanFam3.1:25:14182894:14218613:1 gene:ENSCAFG00000007083 transcript:ENSCAFT00000011353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTTKVEQVKLLDRFSTSNKSLTGTLYLTATHLLFIDSHQKETWILHHHIALVEKLA
LTTSGCPLVIQCKNFRIVHFIVPRERDCHDIYNSLLQLSKQAKYEDLYAFSYNPKQNDSE
RLQGWQLIDLAEEYKRMGVPNSNWQLSDANREYKICETYPRELYVPRIASKPIIVGSSKF
RSKGRFPVLSYYHQNKEAAICRCSQPLSGFSARCLEDEHLLQAISKANPVNRYMYVMDTR
PKLNAMANRAAGKGYENEDNYSNIRFQFVGIENIHVMRSSLQKLLEVNGTKGLSVSDFYS
GLESSGWLRHIKAVMDAAIFLAKAIMVENASVLVHCSDGWDRTSQVCSLGSLLLDSYYRT
IKGFMVLIEKDWISFGHKFSERCGHLDGDPKEVSPVFTQFLECVWHLTEQFPQAFEFNEA
FLLQIHEHIHSCQFGNFLGNCQKEREELKLKEKTYSLWPFLLDDQKKYLNPLYSSKSPKF
AVLEPNTVSFNFKFWRNMYHQFDRTLHPRQSMFNIIMNMNEQNEQLENDIKDLESKIKQR
KSKQTDGILTKELLHSVHPESPTLKTSLCFKEQTLLPVNHALRTIEGSNPADNRYSEYAE
EYSKSEPGVVSLEYGVARMTC
Download sequence
Identical sequences E2RLT3
XP_534530.3.84170 ENSCAFP00000010517 ENSCAFP00000010517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]