SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010541 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010541
Domain Number 1 Region: 1261-1403
Classification Level Classification E-value
Superfamily PH domain-like 2.32e-51
Family Phosphotyrosine-binding domain (PTB) 0.00000011
Further Details:      
 
Domain Number 2 Region: 301-414
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.9e-31
Family PLC-like (P variant) 0.0048
Further Details:      
 
Domain Number 3 Region: 129-299
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6e-24
Family Dual specificity phosphatase-like 0.00049
Further Details:      
 
Domain Number 4 Region: 1107-1251
Classification Level Classification E-value
Superfamily SH2 domain 9.15e-24
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 24-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000121
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010541   Gene: ENSCAFG00000007105   Transcript: ENSCAFT00000011380
Sequence length 1405
Comment pep:known_by_projection chromosome:CanFam3.1:27:2096772:2111816:-1 gene:ENSCAFG00000007105 transcript:ENSCAFT00000011380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRASSRPRKAEPHSFREKVFRKKPPVCAVCKVTVDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPAELGRNTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLGLILH
YAPQRRQSCTPTPAQVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKG
KLGVIVSAYMHYSKISAGADQALATLTMRKFCEDKVAAELQPSQRRYISYFSGLLSGSIR
MNSSPLFLHYVLVPVLPAFEPGTGFQPFLKIYQSMQLVYTSGIYHIAGPGPQQLCISLEP
ALLLKGDVMVTCYHKGGRGTDRTLVFRVQFHTCTIHGPRLTFPKDQLDEAWAGEWETGVG
PEPGAAAPHWNDPSVSVDYNTAEPAVRWDSYEHFNQHHEDSVDGSPTHTRGPLDGSPYAQ
VQRAPRQTPPAPSPEPPPPPMLSVSSDSGHSSTLTAEPAAESPGRPPPTAAERQELDRLL
GGCGVAGPGRGAGRETAILDDEEQPPAAAGPPLGVYSGRRPGLSRHCSCRQGYREPCGVP
NGGYYRPEGTLDRRRLAYGGYEGHPQGYAEAAVEKRRLCRSLSEGPYPYGPELGKAASAD
FGYRAPGYRELVILEDPGLPALCSCPACEEKLALPTAALYGLRLEREAGEGWAGEAGKPL
LHPLRPGHPLPLLVPACGHHHAPMPDYGCLKPPKASEDGHEGCSCALCPDGRYGHPGYPA
LVTYGYGGALPSYCPAYGRVPQSCGSPGEGRGYPSSGAHSPRAGSVSPGSPPYPPPRKLS
YEIPAEEGGDRYPMPGHLAPAGPLASAESPEPASWREGPSGHSTLPRSPRDAPRSAPSEL
SGPSTPLHTSSPVQGKDGTRRQDTTSPTLVPTQRPSPGEPLPSVPQGGAEEKAPEAPARS
GLELPAPSPFPAASPPGSPHDWPQERSPGSRSDSASPRGPVPTTLPGLRHAPWQGLRDPP
DSPDGSPLTPVPTQMPWLVASPEPPQSSPTPAFPVAASYDISGPSQPPLPEKRHLLGPGQ
QPGPWGPEQASPPARGTSHHVTFAPLLPDQVPQPPEPPAQESQSNVKFVQDTSKFWYKPH
LSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATAPPSAQPWRGDPLEQLVRHFLI
ETGPKGVKIKGCPSEPYFGSLSALVSQHSISPLSLPCCLRIPSKDPLEETPEAPAPANMS
TAADLLRQGAACSVLYLTSVETESLTGPQAVARASSAALSCSPRPTPAVVHFKVSAQGIT
LTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGTTSKIFGFVAKKPGSPWENVCHLF
AELDPDQPAGAIVTFITKVLLGQRK
Download sequence
Identical sequences F1PKR8
ENSCAFP00000010541 ENSCAFP00000010541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]