SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010557 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010557
Domain Number 1 Region: 705-922
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-60
Family DBL homology domain (DH-domain) 0.0000000551
Further Details:      
 
Domain Number 2 Region: 908-1061
Classification Level Classification E-value
Superfamily PH domain-like 9.04e-45
Family Pleckstrin-homology domain (PH domain) 0.0000018
Further Details:      
 
Domain Number 3 Region: 606-732
Classification Level Classification E-value
Superfamily SH3-domain 5.12e-23
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010557   Gene: ENSCAFG00000007115   Transcript: ENSCAFT00000011396
Sequence length 1129
Comment pep:novel chromosome:CanFam3.1:25:14650639:14728607:1 gene:ENSCAFG00000007115 transcript:ENSCAFT00000011396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSFKKLKSSVLQGIQNREGSEAAKEDAPERDPGKPIPNGAAVAMQASRCASLGPGRDAP
RAGPGAASDCSDPEEADDAFQRSTHRSRSLRRAYGLGRISLLDGDKHPGPQERAACEILL
KDSENNSIVYRKSKSTDSLNFLKKSSFKRKSTSNLTDLKAAPEKPGPRRTLSSCSADSEK
LGGPERRAKRWRSPLRARDWDRVLKLVSSAADAAWRRESPRAAPAPAPAPGDASQRLQVH
SRLHDAYSRRASTGAERDWRRCAGAHAGPGGPAAGGAPGAQVDAGPAAAEGGSPSPSPPP
RDADQRAAGSSSASDPEQPLTPLRPTTPKPPSPQSPGAGHAACPTSLSALSLSSVDSEER
AEGPGSSPDSGQASWVKGGEDSTSSHAGQSPHPALGPEERREEVMTEESWRRGSSRDEER
TESQRITRRKWGSGRRSRPRPLSDYGQLAHRSLSIPEDSIAVDPQKEDTSEGDHQPNTAP
IVPADQNPAVGCPRGSRRRRPISVIGGVSFYGNSQTEEIESLLAQPAARPPVPAHQVLPY
KAVSARLRPFTFSQSTPIGLDRVGRRRQMRASNVSSDGGTESAALVDDNGSEEDYSYEDL
CQANPRYLQPGGEQLAINELIGDGSVVCAEALWDHVTMDDQELGFKAGDVIQVLEASNKD
WWWGRNEDKEAWFPASFVRLRVNQEELSENSSSTQGEEQEEDAGKSRHKHAESKHQMRTN
VIQEIMNTERVYIKHLKDICEGYIRQCRKHTGMFTVAQLATIFGNIEDIYKFQRKFLKDL
EKQYNKEEPHLSEIGSCFLQHQEGFAIYSEYCNNHPGACAELSNLMKQGRYRHFFEACRL
LQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTTQEHSDYNNIKAAYEAMKNVACLINE
RKRRLESIDKIARWQVSIVGWEGLDILDRSSELIHSGELTKISKHGKSQQRTFFLFDHQL
VSCKKDLLRRDVLYYRGRTDMDEVELVDLEDGRDKDWNLHVKNAFKLVSRTTDEVHLFCA
KKHEDKARWLQACGDERRRVQEDREMGMEISENQKKLAMLNAQKAGHGKSKGYSGCPVAP
PHQSLHPLHQRHITVPTSIPQQQVFALAEPKRKPSLFWHTFNKLTPFKK
Download sequence
Identical sequences F1PKQ8
ENSCAFP00000010557 ENSCAFP00000010557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]