SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010559 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010559
Domain Number 1 Region: 421-542
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-22
Family Pleckstrin-homology domain (PH domain) 0.000000633
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000010559
Domain Number - Region: 305-405
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00687
Family Synaptotagmin-like (S variant) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010559   Gene: ENSCAFG00000007072   Transcript: ENSCAFT00000011398
Sequence length 1259
Comment pep:known_by_projection chromosome:CanFam3.1:20:28221081:28680857:1 gene:ENSCAFG00000007072 transcript:ENSCAFT00000011398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSEKEKEELERLQKEEEERKKRLQLYVFVMRCIAYPFNAKQPTDMARRQQKISKQQLQT
VKDRFQAFLNGETQIVADEAFMNAVQSYYEVFLKSDRVARMVQSGGCSANDSREVFKKHI
EKRVRSLPEIDGLSKETVLSSWMAKFDAIYRGEEDPRKQQARMTASAASELILSKEQLYE
MFQNILGIKKFEHQLLYNACQLDNPDEQAAQIRRELDGRLQMADQIARERKFPKFVSKEM
ENMYIEELKSSVNLLMANLESMPVSKGGEFKLQKLKRSHNASIIDMGEESENQLSKSDVV
LSFSLEVVIMEVQGLKSLAPNRIVYCTMEVEGGEKLQTDQAEASKPTWGTQGDFSTTHAL
PAVKVKLFTESTGVLALEDKELGRVILHPTPNSPKQSEWHKMTVSKNCPDQDLKIKLAVR
MDKPQNMKHSGYLWAIGKNVWKRWKKRFFVLVQVSQYTFAMCSYREKKAEPQELLQLDGY
TVDYTDPQPGLEGGRAFFNAVKEGDTVIFASDDEQDRILWVQAMYRATGQSHKPVPPTQV
QKLNAKGGTVPQLDAPISQFSGLKDADRAQKHGMDEFISSNPCNFDHASLFEMVQRLTLD
HRLNDSYSCLGWFSPGQVFVLDEYCARNGVRGCHRHLCYLRDLLERAENGAMIDPTLLHY
SFAFCASHVHGNSQQMHAYLSGLLPHTDPEGSKTPSPSEPEAKKDTKKESKKRKDYKTQA
NPEPKRPDGIGTVTVEEKERFEEIKERLRVLLENQITHFRYCFPFGRPEGALKATLSLLE
RVLMKDIVTPVPQEEVKTVIRKCLEQAALVNYSRLSEYAKIEENQKDAENVGRLITPAKK
LEDTIRLAELVIEVLQQNEEHHAEAFAWWSDLMVEHAETFLSLFAVDMDAALEVQPPDTW
DSFPLFQLLNDFLRTDYNLCNGKFHKHLQDLFAPLVVRYVDLMESSIAQSIHRGFERESW
EPVNNGSGTSEDLFWKLDALQTFIRDLHWPEEEFGKHLEQRLKLMASDMIESCVKRTRIA
FEVKLQKTSRSTDFRVPQSICTMFNVMVDAKAQSTKLCSMEMGQEHQYHSKIDELIEETV
KEMITLLVAKFVTILEGVLAKLSRYDEGTLFSSFLSFTVKAASKYVDVPKPGMDVADAYV
TFVRHSQDVLRDKVNEEMYIERLFDQWYNSSMNVICTWLTDRMDLQLHIYQLKTLIRMVK
KTYRDFRLQGVLDSTLNSKTYETIRNRLTVEEATASVSEGGGLQGISMKDSDEEDEEDD
Download sequence
Identical sequences E2RLM0
ENSCAFP00000010559 ENSCAFP00000010559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]