SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010595 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010595
Domain Number 1 Region: 284-575
Classification Level Classification E-value
Superfamily BEACH domain 1.57e-116
Family BEACH domain 0.0000000619
Further Details:      
 
Domain Number 2 Region: 614-915
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.11e-57
Family WD40-repeat 0.00088
Further Details:      
 
Domain Number 3 Region: 192-285
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-17
Family PreBEACH PH-like domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010595   Gene: ENSCAFG00000007130   Transcript: ENSCAFT00000011435
Sequence length 917
Comment pep:known_by_projection chromosome:CanFam3.1:29:9371714:9412223:-1 gene:ENSCAFG00000007130 transcript:ENSCAFT00000011435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVSQQEQRMKKLCSFSKFRFSLLLLNLEEYYFEQHTANHIQNKGGQNERKIRGSLKICS
KSVIFEPDAISQPIIKIPLRDCIKIGKHGENGSNRHFAKTKSGEISLIFSQVYFIKEHNI
VAPYKIERGKMEYVFELDVSGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLART
SFDKNRFQSVSEKLHMECKAEMVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQITLQDV
RRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAERTAES
YTLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIISDYCSAELDLSNPGTFRDLS
RPVGALNKERLERLLARYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN
ADRMFNSIGETWKNCLDGATDFKELIPEFYGDDVSFLVNNLKLDLGKRQGGQMVDDVELP
PWARSPEDFLQKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVD
LNSIEDPDEKVAMLTQILEFGQTPKQLFVTPHPRRITPKFKNFSQTYSHNAPMADSPGEE
SFEDLTEESKTLAWNNIAKLQLHDQYKIHKEAVTGIAVSCNGSSVFTTSQDSTLKMFSKE
SKMLQRSISFSNMALSSCLLLPGDATVISSSWDNNIYFYSIAFARRQDTLMGHDDAVSKI
CWHDNRLYSASWDSTVKVWSGVPAEMTCTRRQRFDMLAELEHDVSVDTISLNAASTLLVS
GTKEGTVNIWDLTTATMLHQIPCHSGTVCDAAFSPDSRHVLSTGEDGCLNVIDVQTGMLI
SSMTSDEPQRCFIWDGNSVLSGSQSGELLVWDLLGGKISERIQGHTGAVTCIWMNEQCSS
IITGGEDRQIMFWKLQY
Download sequence
Identical sequences F1PJY5
ENSCAFP00000010595 ENSCAFP00000010595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]