SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000010883 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000010883
Domain Number 1 Region: 302-560
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.05e-65
Family Nuclear receptor ligand-binding domain 0.00000000085
Further Details:      
 
Domain Number 2 Region: 230-307
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.05e-28
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000010883   Gene: ENSCAFG00000007338   Transcript: ENSCAFT00000011743
Sequence length 562
Comment pep:known_by_projection chromosome:CanFam3.1:27:2947619:2955829:-1 gene:ENSCAFG00000007338 transcript:ENSCAFT00000011743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCIQAQYGTPAPSPGPRDHLASDPLTPELSKPTMDLASPEAAPTAPTALPSFSTFMDGY
TGEFDTFLYQLPGTAQPCSSASSSASSTSSSSATSPASPCSAPSPSTPSFQPPQLSPWDG
SFGPFSPSQTYEGLRAWTEQLPKASGHPQPPAFFSFSPPTGPSPSLAQSPLKLFPSQATC
QLGERESYSISTAFPGLAPTSPHLDGPGMLDAPVPSAKARSGAPSGSEGRCAVCGDNASC
QHYGVRTCEGCKGFFKRTVQKNAKYICLANKDCPVDKRRRNRCQFCRFQKCLAVGMVKEV
VRTDSLKGRRGRLPSKPKQPPDASPANLLTSLVRAHLDSGPSTAKLDYSKFQELVLPHFG
KEDAGDVQQFYDLLSGSLEVIRKWAEKIPGFAELSPGDQDLLLESAFLELFILRLAYRSK
PAEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSRSLHGLVVDVPAFACLSALVLITDRH
GLQEPRRVEELQNRIASCLKEHVSAVAGEPQPASCLSRLLGKLPELRTLCTQGLQRIFYL
KLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences K9J6P0
ENSCAFP00000010883 ENSCAFP00000010883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]