SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011007 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011007
Domain Number 1 Region: 52-159
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-36
Family Pleckstrin-homology domain (PH domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily PDZ domain-like 1.26e-17
Family PDZ domain 0.00031
Further Details:      
 
Weak hits

Sequence:  ENSCAFP00000011007
Domain Number - Region: 187-292
Classification Level Classification E-value
Superfamily PH domain-like 0.00106
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011007   Gene: ENSCAFG00000007410   Transcript: ENSCAFT00000011871
Sequence length 396
Comment pep:known_by_projection chromosome:CanFam3.1:24:22636189:22661619:-1 gene:ENSCAFG00000007410 transcript:ENSCAFT00000011871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQVLKKTGKEVVLEVKYM
KEVSPYFKNSAGGTSVGWDSPPASPLPRQPSSPGPSPRDLSDAKHMSLKMAYVSRRCTST
DPEHRYLEICSADGQDTLFLRAKDEASAKSWAAAIQAQVNALMPWVKDELQALLAATSTT
GSQDIKQIGWLTEQLPNGGTAPTLALLTEKELLLYCHLPQTREALSQPSRTAPLIATRLV
HSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQELATWTRQLVDGCHRAAEGVQE
VSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMSSDDGASLLFLDFG
GAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA
Download sequence
Identical sequences E2RIV7
ENSCAFP00000011007 ENSCAFP00000011007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]