SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011038 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011038
Domain Number 1 Region: 113-305
Classification Level Classification E-value
Superfamily PH domain-like 6.85e-42
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 2 Region: 3-83,154-163
Classification Level Classification E-value
Superfamily EF-hand 0.00000659
Family Calmodulin-like 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011038   Gene: ENSCAFG00000007424   Transcript: ENSCAFT00000011904
Sequence length 585
Comment pep:known_by_projection chromosome:CanFam3.1:21:32909813:32985951:1 gene:ENSCAFG00000007424 transcript:ENSCAFT00000011904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLKDELLKGIWHAFTALDLDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDD
EGPVSNQGYMPYLNKFILEKVQDNFDKIEFNRMCWTLCVKKNLTKSPLLITEDDAFKVWV
IFNFLSEDKYPLIIVPEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKDGLSVWELIE
LIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIIS
YYVSEDLKDKKGDILLDENCCVESLPDKDGKKCLFLIKCFDKTFEISASDKKKKQEWIQA
IHSTIHLLKLGSPPPHKEARQRRKELRKKLLAEQEELERQMKELQAANENKQQELETVRK
KLEEAASRAAEEEKKRLQTQVELQARFSTELEREKLIRQQMEEQVAQKSSELEQYLQRVR
ELEDMYLKLQEALEDERQARQDEETVRKLQARLLEEESSKRAELEKWHLEQQQAIQTTEA
EKQELENQRVMKEQALQEAMEQLEQLELERKQALEQYEGVKKKLEMATSKTKSWKDKVAQ
HEGLIRLIEPGSKNPHLITNWGPAAFTQAELEEREKSWKGKKSTE
Download sequence
Identical sequences F1P9B2
ENSCAFP00000011038 ENSCAFP00000011038 XP_542503.3.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]