SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCAFP00000011052 from Canis familiaris 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCAFP00000011052
Domain Number 1 Region: 97-361
Classification Level Classification E-value
Superfamily RNI-like 1.88e-42
Family 28-residue LRR 0.038
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000144
Family F-box domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCAFP00000011052   Gene: ENSCAFG00000007436   Transcript: ENSCAFT00000011918
Sequence length 392
Comment pep:known chromosome:CanFam3.1:3:3548418:4083366:1 gene:ENSCAFG00000007436 transcript:ENSCAFT00000011918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CHREPPATHLRVQALPMGAASLIFSNLSLDERCLSASLVCKYWRDLCLDFQFWKQLDLSS
RQQVTDELLEKIASRSQNIIEINISDCRSMSDTGVCVLAFKCPGLLRYTAYRCKQLSDTS
IIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYKISDEGMIVIAKGC
LKLQRIYMQENKLVTDQSVKAFAEHCPELQYVGFMGCSVTSKGVIHLTKLRNLSSLDLRH
ITELDNETVMEIVKRCKNLSSLNLCLNWIINDRCVEVIAKEGQNLKELYLVSCKITDYAL
IAIGRYSMTIETVDVGWCKEITDQGATLIAQSSKSLRYLGLMRCDKVNEVTVEQLVQQYP
HITFSTVLQDCKRTLERAYQMGWTPNMSAASS
Download sequence
Identical sequences F1P8M5
ENSCAFP00000011052 ENSCAFP00000011052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]